SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|332796455|ref|YP_004457955.1| from Acidianus hospitalis W1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|332796455|ref|YP_004457955.1|
Domain Number 1 Region: 8-167
Classification Level Classification E-value
Superfamily HIT-like 1.7e-41
Family HIT (HINT, histidine triad) family of protein kinase-interacting proteins 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|332796455|ref|YP_004457955.1|
Sequence length 180
Comment histidine triad (HIT) protein [Acidianus hospitalis W1]
Sequence
MANIFNIMDFLWAPWRSKYVADSSKSKREEKCIFCEFPEQNDDERNLIVYRSKYAYIILN
RFPYNPSHVMIVPYRHISSVELLEDNEAQDIFRLIKITLAAIRKVYSPDGFNIGINIGRT
AGAGIEAHVHVHIVPRWNGDANFMPVLSNTKVLPEDLETTYVKLKKAIEDIINNEDSLDH
Download sequence
Identical sequences F4B7Y0
2014260627 gi|332796455|ref|YP_004457955.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]