SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|332796460|ref|YP_004457960.1| from Acidianus hospitalis W1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|332796460|ref|YP_004457960.1|
Domain Number 1 Region: 1-143
Classification Level Classification E-value
Superfamily Bacterial fluorinating enzyme, N-terminal domain 3.4e-45
Family Bacterial fluorinating enzyme, N-terminal domain 0.0011
Further Details:      
 
Domain Number 2 Region: 148-240
Classification Level Classification E-value
Superfamily Bacterial fluorinating enzyme, C-terminal domain 3.27e-18
Family Bacterial fluorinating enzyme, C-terminal domain 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|332796460|ref|YP_004457960.1|
Sequence length 252
Comment hypothetical protein Ahos_0776 [Acidianus hospitalis W1]
Sequence
MEAVIRRINNEVDITYITPNSKNFNLYAASYLLYTAYKYFRKGSIFLVVVDPGVGTSRKA
LLVKSKNYFFIGPDNGVLYPAISEDGIDEVIEISNPRLYLSKNISRTFHGRDIFATTAGF
ASAGVDIHTFGPKISKDELVKLSYNYNIIKDKNLVCGKIIYIDHFGNIATSIRNISFVDE
NVKIIFNNNRLIARKVNTFGESKGNEFLVYKNGYGFIEIGINKENASIKLNASEGEDICL
EGSIQEDSSHST
Download sequence
Identical sequences F4B7Y5
gi|332796460|ref|YP_004457960.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]