SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|332796531|ref|YP_004458031.1| from Acidianus hospitalis W1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|332796531|ref|YP_004458031.1|
Domain Number 1 Region: 90-234
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 4.57e-51
Family C-terminal domain of ribosomal protein L2 0.00000883
Further Details:      
 
Domain Number 2 Region: 2-86
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 6.28e-17
Family Cold shock DNA-binding domain-like 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|332796531|ref|YP_004458031.1|
Sequence length 238
Comment 50S ribosomal protein L2 [Acidianus hospitalis W1]
Sequence
MGKSLLQQRAGRGNINFRNPGWLRVGKVRYPKIEGNHVGKVIDILHNPGMLAPVAKVKLD
TGDVFYMQAVQGMTVGQKIEIGSNVNPATGNIVEVGNLPEGAIICNVEEHYGDGGRYARA
AGSYATVIGKSGDRVLIRLPSGKIKEVLSNARATVGMVAGGGVYDKPMLKAGNVYWKYKV
KATKWPIVKGVAMNAVDHPHGGGLHTSVSRPSTVSRNAPPGRKVGHIAARRTGRKERK
Download sequence
Identical sequences F4B8D4
gi|332796531|ref|YP_004458031.1| WP_013775649.1.74519

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]