SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|332796596|ref|YP_004458096.1| from Acidianus hospitalis W1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|332796596|ref|YP_004458096.1|
Domain Number 1 Region: 1-123
Classification Level Classification E-value
Superfamily YjgF-like 2.36e-46
Family YjgF/L-PSP 0.00000606
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|332796596|ref|YP_004458096.1|
Sequence length 125
Comment endoribonuclease L-PSP [Acidianus hospitalis W1]
Sequence
MKEIIYTEKAPKPIGPYSQAVKLGNLIFVSGQIPLDPKSNNVVNGGIKEQTAQVLENIKA
ILEASGSGLDKVLMSFVYLKSMNDFQGFNEVYSMYFKDNPPARVTVEVSKLPKDVLIEIA
VIAGI
Download sequence
Identical sequences F4B8S8
gi|332796596|ref|YP_004458096.1| WP_013775714.1.74519

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]