SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|332796713|ref|YP_004458213.1| from Acidianus hospitalis W1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|332796713|ref|YP_004458213.1|
Domain Number 1 Region: 91-490
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.77e-104
Family Amylase, catalytic domain 0.000000000119
Further Details:      
 
Domain Number 2 Region: 3-90
Classification Level Classification E-value
Superfamily E set domains 6.65e-16
Family E-set domains of sugar-utilizing enzymes 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|332796713|ref|YP_004458213.1|
Sequence length 559
Comment alpha-amylase [Acidianus hospitalis W1]
Sequence
MDIGANFDGKSTFFRVWAPYNKEVFLVLYKDGERKVIKMELEDEERGYFSVEVDNAKPGD
MYTYMIGGKEYPDPASRFQPEGVHGKSQIIGDFSWDDYNWKGIDFPIIYELHVGTFGGDF
EGVKRKLDYLKELGVTAIELMPVHQFAGNRNWGYDGVLLYAVQNSYGGPQKLKELVNEAH
KKGLGVILDVVYNHVGPEGNYLSVFGPYFSTRYKTPWGPIFNFDEAYSDEVRHYVVQNAV
YWIKEYHVDGLRLDAVHSIFDNSPKHILEEIRDAVKEANPKALLIAESDLNDPRIILPKD
KCGYCIDAQWSDDFHHSLHALLTGERDSYYADFGEITQLAKAIKDVFVYDGVYSKFRKKT
HGRQVGNLPGNKFVVYAQNHDQVGNRKDGKRLISLVGEKALIAPFLYILSPYIPMIFMGE
EYGETNPFLFFTDFSDPEIIKGLREGRKRELGEYYYDPQDYSTFEKSKLSWKLDERILSL
YKELIRLRKELFNDFSRNVDVKIEGNACIIIRRKEKYLVIACFSKTHLDLKAKSIITTVG
MPSSLPGEVSVGAGVYEEL
Download sequence
Identical sequences F4B9C2
gi|332796713|ref|YP_004458213.1| WP_013775831.1.74519

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]