SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|332796764|ref|YP_004458264.1| from Acidianus hospitalis W1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|332796764|ref|YP_004458264.1|
Domain Number 1 Region: 1-80
Classification Level Classification E-value
Superfamily all-alpha NTP pyrophosphatases 6.05e-19
Family MazG-like 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|332796764|ref|YP_004458264.1|
Sequence length 81
Comment MazG nucleotide pyrophosphohydrolase [Acidianus hospitalis W1]
Sequence
MEIKEAQEKLKEMYLQKDKDRGLFATFTWFTEEVGELAEALLSGEKNKIEEELADVIAWA
ISIANLENIDVEEALRKKYNL
Download sequence
Identical sequences F4B9Q0
WP_013775882.1.74519 gi|332796764|ref|YP_004458264.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]