SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|332796893|ref|YP_004458393.1| from Acidianus hospitalis W1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|332796893|ref|YP_004458393.1|
Domain Number 1 Region: 21-150
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 0.0000000000000835
Family GHMP Kinase, N-terminal domain 0.0052
Further Details:      
 
Domain Number 2 Region: 202-242
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 0.00000115
Family Homoserine kinase 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|332796893|ref|YP_004458393.1|
Sequence length 260
Comment shikimate kinase [Acidianus hospitalis W1]
Sequence
MQAYGGVSIVNAIPSWYGSSMAVNLKVNVEITKGKYNGGSKLISTIITYLKEKFNLEDFD
VKINSEIPQESGLKSSSAVSTALIGEVKRKFELDIDVVKYSAILSILAGVSYTGALDDAV
SAYYGGVSYTYNKEFKIVKKSEPPSDISIIILPKGGRGKVNLNKLRDYELIFYEIFKLSL
SDPITAMKYNGILVGEILGYDLKPVKKALEKGALASGISGNGPSIFAVTKEGEEGPIIDE
FNLYGKVILTKAVGLESEDK
Download sequence
Identical sequences F4B3Q8
gi|332796893|ref|YP_004458393.1| WP_013776011.1.74519

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]