SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|332796968|ref|YP_004458468.1| from Acidianus hospitalis W1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|332796968|ref|YP_004458468.1|
Domain Number 1 Region: 4-51
Classification Level Classification E-value
Superfamily Ribosomal protein L39e 1.83e-18
Family Ribosomal protein L39e 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|332796968|ref|YP_004458468.1|
Sequence length 51
Comment 50S ribosomal protein L39e [Acidianus hospitalis W1]
Sequence
MSTTKPLAKKLRLAKALKSNSAIPAWVILKTNGKVRINPLRRNWRRNSLKV
Download sequence
Identical sequences F4B462
2014258032 WP_013776086.1.74519 gi|332796968|ref|YP_004458468.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]