SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|332797082|ref|YP_004458582.1| from Acidianus hospitalis W1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|332797082|ref|YP_004458582.1|
Domain Number 1 Region: 67-199
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 3.66e-19
Family Cytidylyltransferase 0.013
Further Details:      
 
Domain Number 2 Region: 2-60
Classification Level Classification E-value
Superfamily AF1782-like 0.0000000000000288
Family AF1782-like 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|332797082|ref|YP_004458582.1|
Sequence length 208
Comment cytidyltransferase-related domain-containing protein [Acidianus hospitalis W1]
Sequence
MNDRLSKINIPEYQKIIDLARQYTEDAKYYLDKGDVDTAIVDIAYAEGLLDAVLIINNKD
PDSDISKKVFVGGTFDIIHPGHIEFLREASRLGRVYVSVARDKNSEKIKGRKPINDEEQR
LEVVKSIRYVYDAFLGDEKDFIKSVERVKPDIIFLGPDQHVNIDEFKKELEKRGINAEIV
KMPERINKWKHSSTTSIINEIVSRYCKS
Download sequence
Identical sequences F4B4Q4
WP_013776199.1.74519 gi|332797082|ref|YP_004458582.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]