SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|332797083|ref|YP_004458583.1| from Acidianus hospitalis W1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|332797083|ref|YP_004458583.1|
Domain Number 1 Region: 87-216
Classification Level Classification E-value
Superfamily Riboflavin kinase-like 8.17e-42
Family CTP-dependent riboflavin kinase-like 0.00021
Further Details:      
 
Domain Number 2 Region: 10-76
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000000155
Family MarR-like transcriptional regulators 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|332797083|ref|YP_004458583.1|
Sequence length 218
Comment hypothetical protein Ahos_1402 [Acidianus hospitalis W1]
Sequence
MLTEICTLSRIINLVKEKGEITQQILAKEFNISQQSVSRKLKELEDANLIIRIETKDGEI
IRLTEKGENLLLNCLNEISSAIAFQHEIRIKGKVTSGLGEGKLFLSLPYYENSFKKFLGF
TPYPGTLNIVIYDRISFENRLLLDTSRYINIPEYRDENRVLGAVKAYPARINDLEPAAIV
IPLRTTHPKSVIEIISPYYLREKLSLKDGDEVLIEALI
Download sequence
Identical sequences F4B4Q5
gi|332797083|ref|YP_004458583.1| WP_013776200.1.74519

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]