SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|332797141|ref|YP_004458641.1| from Acidianus hospitalis W1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|332797141|ref|YP_004458641.1|
Domain Number 1 Region: 1-169
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.35e-34
Family GHMP Kinase, N-terminal domain 0.00028
Further Details:      
 
Domain Number 2 Region: 180-313
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 4.8e-24
Family Mevalonate kinase 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|332797141|ref|YP_004458641.1|
Sequence length 318
Comment mevalonate kinase [Acidianus hospitalis W1]
Sequence
MIEVEVPLKLTLFGEHAVVYGEPAIAMAINEKMKIKIVPYHKMILKSNSLSIKGIKVDLE
EMKLESEETSKVLSYALSTINFFEKEYGTRKNALIEIESPVDPSVGLGTSAAVIVGIVGG
YSRYLGYELTREEIAKISHKIELTVQGLGSRMDTYTTSLGGLIYFHKGGGYEKIRGEIRI
TAGYIRRIATTAEILKRVKSLKEKNPDLFNDLISSIGKTVNKAKIAIEKGDEEEIGELMY
VNHGLLMSLGVTLPPIDNLVSTAKILGLKGCKISGGGGGGSTICLEDERARILLSTIGAK
IIDSGISQEGVMIKEINQ
Download sequence
Identical sequences F4B541
gi|332797141|ref|YP_004458641.1| WP_013776258.1.74519

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]