SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|332797238|ref|YP_004458738.1| from Acidianus hospitalis W1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|332797238|ref|YP_004458738.1|
Domain Number 1 Region: 4-227
Classification Level Classification E-value
Superfamily Purine and uridine phosphorylases 2.36e-51
Family Purine and uridine phosphorylases 0.00000394
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|332797238|ref|YP_004458738.1|
Sequence length 230
Comment purine nucleoside phosphorylase [Acidianus hospitalis W1]
Sequence
MALITAKPGDLGEKAIIVGNLQRMKTVSSLLEDSKLVSEFAGYYTYVGKYKGEKVSVVFH
GIGIPSLTLVTHDLYNLGVKEIIRFGSATGLKDVKPGEVVVPIGYSYNLGGTFYQYLNGE
FTAYALTPDYELLNKVVNNLKAKQLKVRVGNVFTSDALFTHSKEFLDKLSSRNHIAVELE
GAGLYFLANLLGFKAVSVHLIYRNANGESMSAEDINKTEKVIAEALLESL
Download sequence
Identical sequences F4B5L6
WP_013776355.1.74519 gi|332797238|ref|YP_004458738.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]