SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|332797292|ref|YP_004458792.1| from Acidianus hospitalis W1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|332797292|ref|YP_004458792.1|
Domain Number - Region: 38-71
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.0239
Family GalR/LacI-like bacterial regulator 0.061
Further Details:      
 
Domain Number - Region: 81-141
Classification Level Classification E-value
Superfamily V-type ATPase subunit E-like 0.0837
Family V-type ATPase subunit E 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|332797292|ref|YP_004458792.1|
Sequence length 158
Comment hypothetical protein Ahos_1616 [Acidianus hospitalis W1]
Sequence
MCNMLHMIEKQVLAKVLSVSLSDSEILNLLGKLKENDSELERECGISRKTIYNWKKGKVG
EISRETKEKLVSFILNKYDKEGLMTIAEVKRYSYIQILLELMREGLNEEEKRKLEVIVKD
DKVSGGEAVIPNSTPAYSDYSSNYNKTTNSSLLSLSLH
Download sequence
Identical sequences F4B5Z6
WP_013776409.1.74519 gi|332797292|ref|YP_004458792.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]