SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|332797443|ref|YP_004458943.1| from Acidianus hospitalis W1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|332797443|ref|YP_004458943.1|
Domain Number - Region: 28-58
Classification Level Classification E-value
Superfamily AF1782-like 0.0017
Family AF1782-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|332797443|ref|YP_004458943.1|
Sequence length 156
Comment PaREP1 family protein [Acidianus hospitalis W1]
Sequence
MEELIKKAEEKGIDVEDLIIFTLSKEDPSEGIKMRIELAKKYMAEAEEYLKKGDAVQASE
KAYKVAEEVLKALAEKFNTPEYQQAVKEGRWYTYLLSKATNTLSSTLGDKIIKGWSSAYL
LHVWGFHEAKLETKDIMSYINVVKEMLEEANKYLSM
Download sequence
Identical sequences F4B6V2
gi|332797443|ref|YP_004458943.1| WP_013776560.1.74519

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]