SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|332797444|ref|YP_004458944.1| from Acidianus hospitalis W1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|332797444|ref|YP_004458944.1|
Domain Number 1 Region: 134-291
Classification Level Classification E-value
Superfamily Restriction endonuclease-like 0.000000000983
Family Hypothetical protein VC1899 0.054
Further Details:      
 
Domain Number 2 Region: 51-158
Classification Level Classification E-value
Superfamily Apolipoprotein 0.0000432
Family Apolipoprotein 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|332797444|ref|YP_004458944.1|
Sequence length 291
Comment hypothetical protein Ahos_1770 [Acidianus hospitalis W1]
Sequence
MSEEIRKWFNDFVNSIVEKIKTGKELNALETQIISNYASNLVLYDYVDKRLGELERNLRD
EIRKTREELLANDEKVKQELLANDERIKQELLANDERIKQELLQKIEEVKKELLANDEKV
KQELLANDERIKQELLQKIEEVKKELLANDERIKQGLKAEIQSVKTDLENKIKEVDRKVE
ATRSDLGLLAEEVYVKNFVDYLESNGEKVVSVYRHYETSLGEIDAVVETSGKVYVVEVKM
RAEVSDVDDLLNKTKVLKEELGGKEVYPVLTGSKINKTVRGYAKGLGVLII
Download sequence
Identical sequences F4B6V3
gi|332797444|ref|YP_004458944.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]