SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|332797612|ref|YP_004459112.1| from Acidianus hospitalis W1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|332797612|ref|YP_004459112.1|
Domain Number 1 Region: 198-434
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.78e-59
Family Leukotriene A4 hydrolase catalytic domain 0.00043
Further Details:      
 
Domain Number 2 Region: 16-188
Classification Level Classification E-value
Superfamily Leukotriene A4 hydrolase N-terminal domain 2.48e-24
Family Leukotriene A4 hydrolase N-terminal domain 0.004
Further Details:      
 
Domain Number 3 Region: 481-651
Classification Level Classification E-value
Superfamily ARM repeat 3.53e-18
Family PBS lyase HEAT-like repeat 0.018
Further Details:      
 
Weak hits

Sequence:  gi|332797612|ref|YP_004459112.1|
Domain Number - Region: 656-734
Classification Level Classification E-value
Superfamily ARM repeat 0.000351
Family PBS lyase HEAT-like repeat 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|332797612|ref|YP_004459112.1|
Sequence length 735
Comment peptidase M1, membrane alanine aminopeptidase [Acidianus hospitalis W1]
Sequence
MVDRVGKNYVLKEHEIHYPENYDFRILHYIYYLEIYPEESRIKGKAVVKFLGKDLILHAR
HFQINKIKLDGKEANYSYDGEKISIQREGKEAEIEYEAKPVLGLIFKKLKEYIEVATTGE
VDQARNWIPILDDPRVKTTTEFYIKVRKPYIALSNGRLIDKEEDGDFITFHWLMDKPHSP
YLNSIAVGMFSKEEDEWEGVKLENYLPKGYEEFFWNLSSVKKAIEFFSSYTGVKYPYCRY
AQVVLFSMNGGMEYITSTHLTWRVIHDKVAEKNYSSENLIAHELAHQWFGDLITTKDWPN
IWLNEGFASYFEALYVEHEKGREEFLYNLYNKWKGYEEEKEKYTRPIVCRYYKWGDELFD
RHTYNKGALFLHKLRNFLGDETFRKGIKEYLERFKYRSVDTEDFKKVMEEVSGKDLTFLF
DQFVYSAFNPSVEVTSIDGGVRIKNEVEVDVKIGKEIRKVKPGESLLSGAYVCVDPNFTS
LAEVEDKQGEEALIKESKDEELICRIRAVTSLSRFSDFKAIQALKERLENDFWGVSYESA
ISLGKIKNDDALNALMLNHENPKVMVGIAKALGEFKFNQKAKNFLLEVMDKAESYHVRAE
AIVSLGKIGFTDVKEKIISHFEDESYADVVPSAVIEALSYFGDDESFRFVIDRGFKNEKE
TIRAAFARNLWRFGDKSREYLYYLVKDPSPIVRGATIKSLEELKMKDLLRTIVDNEDEEL
RNRSNALRVLYKLGQ
Download sequence
Identical sequences F4B7R7
WP_013776729.1.74519 gi|332797612|ref|YP_004459112.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]