SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|332797626|ref|YP_004459126.1| from Acidianus hospitalis W1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|332797626|ref|YP_004459126.1|
Domain Number 1 Region: 14-199
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 2.99e-63
Family FAD-linked oxidases, N-terminal domain 0.012
Further Details:      
 
Domain Number 2 Region: 204-429
Classification Level Classification E-value
Superfamily FAD-linked oxidases, C-terminal domain 2.62e-44
Family Vanillyl-alcohol oxidase-like 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|332797626|ref|YP_004459126.1|
Sequence length 436
Comment FAD linked oxidase domain-containing protein [Acidianus hospitalis W1]
Sequence
MEELLDIEHSKEEREDFAGYKISPTMIFFPKNESEVVRIVKYAYTHNIPIVPWGSGSSLT
GATACKDCILVDLSKMDKILEINDVDWYVRVQPGVKLIDLYEAVESKGFFFPPDPASFFL
CTVGGAISEGSGGMRGVKYGPLREWVLSLRVVLPTGEVVKVGEPLRKNRAGYDLTHLFVG
SEGTLGIITEAWLRIIPKPRKKIYTVKVLLPDFSTVAENIIGIRKARILPEFSEYIDADV
IRALNRNLNAGLEESEGGMLLISIEEDQLQDLLKVLKGKVEVLEGDEAERLYSLRSQAAI
AVKAETRTFYAEDIVVPISKLPEAISKLNEIAKKHNTKFYIISHIGDGNLHPNIVVDDEK
EKEEIFNEIAKVAIDLGGSVTGEHGVGIQKAKMMSEQIKSHNGERVLDLMIGIKKMLDPK
NIMNPDKYVELAYKFK
Download sequence
Identical sequences F4B7T1
gi|332797626|ref|YP_004459126.1| WP_013776743.1.74519

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]