SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|332797684|ref|YP_004459184.1| from Acidianus hospitalis W1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|332797684|ref|YP_004459184.1|
Domain Number 1 Region: 4-124
Classification Level Classification E-value
Superfamily Nucleotidyltransferase substrate binding subunit/domain 2.31e-23
Family HEPN domain 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|332797684|ref|YP_004459184.1|
Sequence length 130
Comment HEPN domain-containing protein [Acidianus hospitalis W1]
Sequence
MSFLRDNARQFLEQAKFSMERGFYNLVLFNVEQSIQLNLKFLLYSLTGDFPKTHKISELF
KYVINILDNSCNLSNFYEENKDFISIIEFSYISSRYLPQTFSKDDAEKSLRIGEEFSKMI
ENCLKTMQKS
Download sequence
Identical sequences F4B862
gi|332797684|ref|YP_004459184.1| WP_013776801.1.74519

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]