SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|332797892|ref|YP_004459392.1| from Acidianus hospitalis W1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|332797892|ref|YP_004459392.1|
Domain Number 1 Region: 1-178
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 2.14e-31
Family UDP-glucose pyrophosphorylase 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|332797892|ref|YP_004459392.1|
Sequence length 185
Comment 4-diphosphocytidyl-2C-methyl-D-erythritol synthase [Acidianus hospitalis W1]
Sequence
MKIGAVILAAGESKRFGKNKLLEKINGKSIIENVLENVNIERVIIVGKYAEELLPHLKNE
IIIYNPKWKEGISSSIKLGLRFFQNYDGVLIVLGDMPFVKREDIHKIINAFNPDCNAVIP
TYKGNWGNPVLLSRKIFDKVMTITGDEGAKKILKSTENLCFVECDYGVIIDIDTVNDLLT
FEKPP
Download sequence
Identical sequences F4B9E8
gi|332797892|ref|YP_004459392.1| WP_013777009.1.74519

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]