SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|332797894|ref|YP_004459394.1| from Acidianus hospitalis W1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|332797894|ref|YP_004459394.1|
Domain Number 1 Region: 3-168
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 3.43e-47
Family CO dehydrogenase flavoprotein N-terminal domain-like 0.0000439
Further Details:      
 
Domain Number 2 Region: 172-278
Classification Level Classification E-value
Superfamily CO dehydrogenase flavoprotein C-terminal domain-like 1.7e-28
Family CO dehydrogenase flavoprotein C-terminal domain-like 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|332797894|ref|YP_004459394.1|
Sequence length 278
Comment aldehyde dehydrogenase [Acidianus hospitalis W1]
Sequence
MYPPKIGYVIPDNLNEAIDFLKAHDDAKALAGGHSLIPMLKLRIIRPSYLVDITKLKELH
YLNKEEKEYKLGATITHYEISKAQIPLLSEVASKIGDPQVRNMGTIGGSISQLDPSADYP
AALLVLDAKVKIKGPSGERLEEFSSFDKDMFTPDLSQGEIVTEISIPVFPGYKYSYQKLE
RKAGDYAIVGVAVLIKTNGDEVEDFRVGVTGVNNKAYRSQIAEDMIKGKKINDEIIDKVA
QEVANESNPTSDIRGSAEYKRKATKVMTKRAILDALKR
Download sequence
Identical sequences F4B9F0
WP_013777011.1.74519 gi|332797894|ref|YP_004459394.1| 2014259330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]