SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|332798021|ref|YP_004459521.1| from Acidianus hospitalis W1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|332798021|ref|YP_004459521.1|
Domain Number 1 Region: 14-125
Classification Level Classification E-value
Superfamily Bet v1-like 0.0000341
Family CoxG-like 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|332798021|ref|YP_004459521.1|
Sequence length 218
Comment hypothetical protein Ahos_2352 [Acidianus hospitalis W1]
Sequence
MEEEFTLLLPSFNAYDFFSNPSNIIKFIPLFKSISQISDNEFIVSVGWILNIKINVKRIL
AKNRISYIISRSEQPRIMGKLDHIFEPLQGNTNLTKVKIIFYYKGPLEKLIKIESRRFYN
KVKDEIDQNNKEEVSDIEFDNILNQMKTILSGIIKTDDQFDMLINKAVMESINSEIALII
GSDRNSMKFLFDKGNLIKEKGSVENIKSGMKFVMKKKE
Download sequence
Identical sequences F4BA07
gi|332798021|ref|YP_004459521.1| WP_013777138.1.74519 2014256282

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]