SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|197285079|ref|YP_002150951.1| from Proteus mirabilis HI4320

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|197285079|ref|YP_002150951.1|
Domain Number - Region: 281-330
Classification Level Classification E-value
Superfamily Colicin 0.0471
Family Colicin 0.0068
Further Details:      
 
Domain Number - Region: 420-456
Classification Level Classification E-value
Superfamily DEATH domain 0.0549
Family Caspase recruitment domain, CARD 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|197285079|ref|YP_002150951.1|
Sequence length 486
Comment hypothetical protein PMI1219 [Proteus mirabilis HI4320]
Sequence
MMSVKINHNDISSLQILRISQGEKTKDVMSLWDKIKDWFQSNKREKALKIVENIVVEEKF
DDKNNFKMLYHVLMLKTMASDAYKERIKINTNDNDKNITISIDNYNISITDIDNEQLNKM
STIINAFNRHSLIFSNEIALKCLYEKLDKNELNDQIFAELYIELDNKIRSGEIDLKLNKS
NFNQVNFSAIRQLVSKAIENDNTNLDTENDNANLENDNANLENDNINLENDNANLENDNA
NLENDNINLENDNANLENDNANLENDNANLENDNANLNIKKALIKDINRNTYIFNGKEIK
SKDQDEAMEEFETLTKDISEKNKKAIYYLLNQEGITLIKSYNDSFDYYTLTTSFSMSNVV
KQEQIYSIKTLSDDLIELKIKFFKKSSDKINLNIPLAQPFESKLYNFIYDMVAINNNIEI
TYDKILNEKMNEIIKQLNNKKPRLGELFSHLLSRNKIIKEDSVDITLKLNKGQLVSLGGE
CSYNFY
Download sequence
Identical sequences B4ETU9
gi|197285079|ref|YP_002150951.1| WP_012367908.1.2377 529507.PMI1219

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]