SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|197285211|ref|YP_002151083.1| from Proteus mirabilis HI4320

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|197285211|ref|YP_002151083.1|
Domain Number 1 Region: 449-537
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000108
Family Anti-sigma factor antagonist SpoIIaa 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|197285211|ref|YP_002151083.1|
Sequence length 594
Comment sulfate transporter [Proteus mirabilis HI4320]
Sequence
MNGKRIIKWMPGLGLLFNYQREYLGYDIKAGLSVAAVALPVAIAYTELLGINAIVGLYAC
ILPMIMYALFGTSRQLITGPDAATCAVIAAVVIPLSAGDENTRWQLAIIMTAMTGFWCIL
ASHFRFGAFTDFLSRPILQGLLNGVAITIMVGQLSKVFGFTTSPEYLIEKLLEVPFRLKE
AHWPTLLMSALTLALLLCIRHFRQRWPAPLIAMVVMTYLSWQFDLVNYGIAIVDKEADNG
DLFLPIVSMSGFHLGSLRELIVPSINLAVISFVSFMMTARSFASKNGYDVDADQELKALG
IANIASALSQGFAVSAASSRTAVNDSVGGKTQLVSIVAALVILVVLLFMTDFIAYIPLSS
LGVVLIVSSWSLLSIRHIWSYRKRNRQAFTLATFTLLAVLLAGLINGIGFAVLLGLLQFL
RIVFRPSDQLLGVDEQGMIHSINQGNGIESISGLMMYRFNSPLTYFNVGYFKKRVLQLVD
SAPQRPAWLAVDATVSFTYDDVSVFAVIDELIRELRIKGVKLVLAGRRTELNRWIARNKI
TINDDDLIIAPDLYFVIRLYQSRQQIKEKHKQQQQVPFAEDNQATFIRDTETRG
Download sequence
Identical sequences B4EWI2
529507.PMI1352 gi|197285211|ref|YP_002151083.1| WP_012367971.1.2377

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]