SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|218553150|ref|YP_002386063.1| from Escherichia coli IAI1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|218553150|ref|YP_002386063.1|
Domain Number 1 Region: 207-514
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.5e-50
Family FAD/NAD-linked reductases, N-terminal and central domains 0.00000312
Further Details:      
 
Domain Number 2 Region: 1-101
Classification Level Classification E-value
Superfamily Thioredoxin-like 7.52e-29
Family PDI-like 0.00000535
Further Details:      
 
Domain Number 3 Region: 106-197
Classification Level Classification E-value
Superfamily Thioredoxin-like 8.96e-24
Family PDI-like 0.00000802
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|218553150|ref|YP_002386063.1|
Sequence length 521
Comment alkyl hydroperoxide reductase, F52a subunit [Escherichia coli IAI1]
Sequence
MLDTNMKTQLKAYLEKLTKPVELIATLDDSAKSAEIKELLAEIAELSDKVTFKEDNSLPV
RKPSFLITNPGSNQGPRFAGSPLGHEFTSLVLALLWTGGHPSKEAQSLLEQIRHIDGDFE
FETYYSLSCHNCPDVVQALNLMSVLNPRIKHTAIDGGTFQNEITDRNVMGVPAVFVNGKE
FGQGRMTLTEIVAKIDTGAEKRAAEELNKRDAYDVLIVGSGPAGAAAAIYSARKGIRTGL
MGERFGGQILDTVDIENYISVPKTEGQKLAGALKVHVDEYDVDVIDSQSASKLIPAAVEG
GLHQIETASGAVLKARSIIVATGAKWRNMNVPGEDQYRTKGVTYCPHCDGPLFKGKRVAV
IGGGNSGVEAAIDLAGIVEHVTLLEFAPEMKADQVLQDKLRSLKNVDIILNAQTTEVKGD
GSKVVGLEYRDRVSGDIHNIELAGIFVQIGLLPNTNWLEGAVERNRMGEIIIDAKCETNV
KGVFAAGDCTTVPYKQIIIATGEGAKASLSAFDYLIRTKTA
Download sequence
Identical sequences A0A070SUD1 A0A070US00 A0A073FZM6 A0A074I9C3 A0A080G8F4 A0A080JB15 A0A0A0FC28 A0A0E0Y419 A0A0E1LWB1 A0A0H3EGW9 A0A0H3ME84 A0A142H0E2 A0A1E2VLR7 A0A1X3IRS2 A0A1X3J5F5 A0A1X3JKK8 A0A1X3LM01 A0A1Z3UTH5 A0A200LHF4 A0A236LZZ2 A0A236XGR4 A0A2H1BMJ8 B7L8J0 B7MF20 C8U2X1 C8UJS4 E2QHG9 E3PGL6 E9XP48 F3WF38 F4SK90 F4UZF4 F5NRT9 H4UFT0 I2RQ89 I2SZA4 I2ULL0 I2W5A0 I2X7N7 I4SMC3 I6C201 I6DSJ0 I6ESI0 I6G658 K0XCE4 K4W5E3 K4XLJ1 M9GCP6 P35340 V8FKJ0 W1BGY3
gi|218694048|ref|YP_002401715.1| gi|387620351|ref|YP_006127978.1| 4o5q_A 4o5u_A 4xvg_A 4ykf_A 4ykg_A gi|556550719|ref|YP_008720659.1| gi|388476710|ref|YP_488896.1| NP_415139.2.90541 WP_000887629.1.1000 WP_000887629.1.10001 WP_000887629.1.100014 WP_000887629.1.100044 WP_000887629.1.100063 WP_000887629.1.100066 WP_000887629.1.100073 WP_000887629.1.100085 WP_000887629.1.10010 WP_000887629.1.100111 WP_000887629.1.100116 WP_000887629.1.100135 WP_000887629.1.100151 WP_000887629.1.100159 WP_000887629.1.100185 WP_000887629.1.100220 WP_000887629.1.100227 WP_000887629.1.100252 WP_000887629.1.100281 WP_000887629.1.100283 WP_000887629.1.100285 WP_000887629.1.100299 WP_000887629.1.100302 WP_000887629.1.100304 WP_000887629.1.100315 WP_000887629.1.10034 WP_000887629.1.100346 WP_000887629.1.100389 WP_000887629.1.100425 WP_000887629.1.100441 WP_000887629.1.100444 WP_000887629.1.100447 WP_000887629.1.100448 WP_000887629.1.100451 WP_000887629.1.100474 WP_000887629.1.10048 WP_000887629.1.100487 WP_000887629.1.100496 WP_000887629.1.100499 WP_000887629.1.10051 WP_000887629.1.100531 WP_000887629.1.100543 WP_000887629.1.100554 WP_000887629.1.100571 WP_000887629.1.100573 WP_000887629.1.100614 WP_000887629.1.100667 WP_000887629.1.10067 WP_000887629.1.10068 WP_000887629.1.100688 WP_000887629.1.100689 WP_000887629.1.100718 WP_000887629.1.100725 WP_000887629.1.100735 WP_000887629.1.100738 WP_000887629.1.100752 WP_000887629.1.100753 WP_000887629.1.100778 WP_000887629.1.100796 WP_000887629.1.10080 WP_000887629.1.100803 WP_000887629.1.100824 WP_000887629.1.100836 WP_000887629.1.100851 WP_000887629.1.100852 WP_000887629.1.10086 WP_000887629.1.100867 WP_000887629.1.100868 WP_000887629.1.100898 WP_000887629.1.100916 WP_000887629.1.100925 WP_000887629.1.100928 WP_000887629.1.100933 WP_000887629.1.10094 WP_000887629.1.100959 WP_000887629.1.100966 WP_000887629.1.100990 WP_000887629.1.101033 WP_000887629.1.101052 WP_000887629.1.101087 WP_000887629.1.101096 WP_000887629.1.101102 WP_000887629.1.101105 WP_000887629.1.101110 WP_000887629.1.101121 WP_000887629.1.101148 WP_000887629.1.101152 WP_000887629.1.101157 WP_000887629.1.101158 WP_000887629.1.101166 WP_000887629.1.101175 WP_000887629.1.101186 WP_000887629.1.101206 WP_000887629.1.101214 WP_000887629.1.101216 WP_000887629.1.101255 WP_000887629.1.101257 WP_000887629.1.10126 WP_000887629.1.101282 WP_000887629.1.101289 WP_000887629.1.101293 WP_000887629.1.101313 WP_000887629.1.101359 WP_000887629.1.101399 WP_000887629.1.101418 WP_000887629.1.101423 WP_000887629.1.101429 WP_000887629.1.101436 WP_000887629.1.101445 WP_000887629.1.101468 WP_000887629.1.101486 WP_000887629.1.101518 WP_000887629.1.10154 WP_000887629.1.101583 WP_000887629.1.101586 WP_000887629.1.101594 WP_000887629.1.101628 WP_000887629.1.101630 WP_000887629.1.101651 WP_000887629.1.101653 WP_000887629.1.101654 WP_000887629.1.101668 WP_000887629.1.101686 WP_000887629.1.101694 WP_000887629.1.101727 WP_000887629.1.10173 WP_000887629.1.101737 WP_000887629.1.101747 WP_000887629.1.101777 WP_000887629.1.101786 WP_000887629.1.101822 WP_000887629.1.10184 WP_000887629.1.101840 WP_000887629.1.101845 WP_000887629.1.101855 WP_000887629.1.101865 WP_000887629.1.10187 WP_000887629.1.10188 WP_000887629.1.101887 WP_000887629.1.101889 WP_000887629.1.10190 WP_000887629.1.101900 WP_000887629.1.101908 WP_000887629.1.101913 WP_000887629.1.101926 WP_000887629.1.101932 WP_000887629.1.101937 WP_000887629.1.101940 WP_000887629.1.101942 WP_000887629.1.101947 WP_000887629.1.101952 WP_000887629.1.101964 WP_000887629.1.101969 WP_000887629.1.101977 WP_000887629.1.101987 WP_000887629.1.102021 WP_000887629.1.102036 WP_000887629.1.10206 WP_000887629.1.102069 WP_000887629.1.102093 WP_000887629.1.102094 WP_000887629.1.102104 WP_000887629.1.102122 WP_000887629.1.102139 WP_000887629.1.102144 WP_000887629.1.10222 WP_000887629.1.10233 WP_000887629.1.10235 WP_000887629.1.10252 WP_000887629.1.10273 WP_000887629.1.10304 WP_000887629.1.10326 WP_000887629.1.10329 WP_000887629.1.10335 WP_000887629.1.10348 WP_000887629.1.10352 WP_000887629.1.10379 WP_000887629.1.10381 WP_000887629.1.1040 WP_000887629.1.10400 WP_000887629.1.10417 WP_000887629.1.10461 WP_000887629.1.10476 WP_000887629.1.10491 WP_000887629.1.10492 WP_000887629.1.10496 WP_000887629.1.10508 WP_000887629.1.10524 WP_000887629.1.10525 WP_000887629.1.10538 WP_000887629.1.10569 WP_000887629.1.10573 WP_000887629.1.10576 WP_000887629.1.10579 WP_000887629.1.1058 WP_000887629.1.10605 WP_000887629.1.10607 WP_000887629.1.10628 WP_000887629.1.10651 WP_000887629.1.10673 WP_000887629.1.10697 WP_000887629.1.1071 WP_000887629.1.10715 WP_000887629.1.10729 WP_000887629.1.1073 WP_000887629.1.1074 WP_000887629.1.10761 WP_000887629.1.10763 WP_000887629.1.10771 WP_000887629.1.10798 WP_000887629.1.10824 WP_000887629.1.10833 WP_000887629.1.10842 WP_000887629.1.10849 WP_000887629.1.10862 WP_000887629.1.10922 WP_000887629.1.10940 WP_000887629.1.10970 WP_000887629.1.10988 WP_000887629.1.10989 WP_000887629.1.10994 WP_000887629.1.10995 WP_000887629.1.11006 WP_000887629.1.11032 WP_000887629.1.11047 WP_000887629.1.11052 WP_000887629.1.11057 WP_000887629.1.11068 WP_000887629.1.11071 WP_000887629.1.11091 WP_000887629.1.1111 WP_000887629.1.11113 WP_000887629.1.11118 WP_000887629.1.11121 WP_000887629.1.1113 WP_000887629.1.11133 WP_000887629.1.112 WP_000887629.1.11217 WP_000887629.1.1122 WP_000887629.1.11240 WP_000887629.1.11241 WP_000887629.1.11250 WP_000887629.1.11251 WP_000887629.1.11265 WP_000887629.1.11272 WP_000887629.1.11296 WP_000887629.1.11315 WP_000887629.1.11323 WP_000887629.1.11408 WP_000887629.1.11418 WP_000887629.1.11420 WP_000887629.1.11436 WP_000887629.1.11437 WP_000887629.1.11440 WP_000887629.1.11452 WP_000887629.1.11499 WP_000887629.1.11519 WP_000887629.1.11524 WP_000887629.1.11531 WP_000887629.1.11542 WP_000887629.1.11578 WP_000887629.1.11595 WP_000887629.1.11607 WP_000887629.1.11612 WP_000887629.1.11616 WP_000887629.1.11645 WP_000887629.1.11671 WP_000887629.1.11673 WP_000887629.1.1168 WP_000887629.1.11690 WP_000887629.1.11699 WP_000887629.1.11748 WP_000887629.1.11759 WP_000887629.1.1176 WP_000887629.1.11762 WP_000887629.1.11801 WP_000887629.1.11803 WP_000887629.1.11844 WP_000887629.1.1186 WP_000887629.1.11949 WP_000887629.1.11955 WP_000887629.1.1196 WP_000887629.1.11981 WP_000887629.1.11982 WP_000887629.1.11985 WP_000887629.1.12000 WP_000887629.1.12009 WP_000887629.1.12010 WP_000887629.1.12030 WP_000887629.1.12036 WP_000887629.1.12051 WP_000887629.1.12060 WP_000887629.1.12076 WP_000887629.1.12095 WP_000887629.1.12111 WP_000887629.1.12112 WP_000887629.1.1212 WP_000887629.1.12151 WP_000887629.1.12157 WP_000887629.1.1218 WP_000887629.1.12204 WP_000887629.1.12259 WP_000887629.1.12279 WP_000887629.1.12292 WP_000887629.1.12305 WP_000887629.1.12320 WP_000887629.1.12342 WP_000887629.1.12344 WP_000887629.1.12352 WP_000887629.1.12415 WP_000887629.1.1242 WP_000887629.1.12426 WP_000887629.1.12458 WP_000887629.1.12459 WP_000887629.1.12468 WP_000887629.1.12478 WP_000887629.1.12542 WP_000887629.1.12552 WP_000887629.1.12558 WP_000887629.1.12566 WP_000887629.1.12582 WP_000887629.1.12594 WP_000887629.1.12623 WP_000887629.1.12645 WP_000887629.1.12646 WP_000887629.1.12675 WP_000887629.1.12680 WP_000887629.1.12693 WP_000887629.1.127 WP_000887629.1.12717 WP_000887629.1.12743 WP_000887629.1.12749 WP_000887629.1.1275 WP_000887629.1.12756 WP_000887629.1.12761 WP_000887629.1.12766 WP_000887629.1.12775 WP_000887629.1.12781 WP_000887629.1.1280 WP_000887629.1.12831 WP_000887629.1.12876 WP_000887629.1.12911 WP_000887629.1.12914 WP_000887629.1.1295 WP_000887629.1.12956 WP_000887629.1.12976 WP_000887629.1.12979 WP_000887629.1.12987 WP_000887629.1.12991 WP_000887629.1.13002 WP_000887629.1.13015 WP_000887629.1.13031 WP_000887629.1.13060 WP_000887629.1.13074 WP_000887629.1.13117 WP_000887629.1.1312 WP_000887629.1.13136 WP_000887629.1.1315 WP_000887629.1.13162 WP_000887629.1.13176 WP_000887629.1.13181 WP_000887629.1.13205 WP_000887629.1.13217 WP_000887629.1.13222 WP_000887629.1.13223 WP_000887629.1.1323 WP_000887629.1.13239 WP_000887629.1.13252 WP_000887629.1.13258 WP_000887629.1.13271 WP_000887629.1.13278 WP_000887629.1.13290 WP_000887629.1.13301 WP_000887629.1.13332 WP_000887629.1.13333 WP_000887629.1.13346 WP_000887629.1.13348 WP_000887629.1.1335 WP_000887629.1.13383 WP_000887629.1.13393 WP_000887629.1.13411 WP_000887629.1.1343 WP_000887629.1.13430 WP_000887629.1.13437 WP_000887629.1.13442 WP_000887629.1.1345 WP_000887629.1.13451 WP_000887629.1.13481 WP_000887629.1.13492 WP_000887629.1.13495 WP_000887629.1.13525 WP_000887629.1.13566 WP_000887629.1.13585 WP_000887629.1.13589 WP_000887629.1.13601 WP_000887629.1.13608 WP_000887629.1.13618 WP_000887629.1.13624 WP_000887629.1.13644 WP_000887629.1.13656 WP_000887629.1.13662 WP_000887629.1.13664 WP_000887629.1.13672 WP_000887629.1.13740 WP_000887629.1.13791 WP_000887629.1.13798 WP_000887629.1.13867 WP_000887629.1.13877 WP_000887629.1.13881 WP_000887629.1.13891 WP_000887629.1.13924 WP_000887629.1.13934 WP_000887629.1.13936 WP_000887629.1.13939 WP_000887629.1.13944 WP_000887629.1.13949 WP_000887629.1.13974 WP_000887629.1.13981 WP_000887629.1.14023 WP_000887629.1.14030 WP_000887629.1.14058 WP_000887629.1.14062 WP_000887629.1.14070 WP_000887629.1.14094 WP_000887629.1.14110 WP_000887629.1.14127 WP_000887629.1.14129 WP_000887629.1.1419 WP_000887629.1.14199 WP_000887629.1.142 WP_000887629.1.14253 WP_000887629.1.14277 WP_000887629.1.14292 WP_000887629.1.14299 WP_000887629.1.14304 WP_000887629.1.14331 WP_000887629.1.14346 WP_000887629.1.1438 WP_000887629.1.14389 WP_000887629.1.1439 WP_000887629.1.14398 WP_000887629.1.14417 WP_000887629.1.14432 WP_000887629.1.14445 WP_000887629.1.14451 WP_000887629.1.14453 WP_000887629.1.14468 WP_000887629.1.14493 WP_000887629.1.14499 WP_000887629.1.14501 WP_000887629.1.14506 WP_000887629.1.14508 WP_000887629.1.14529 WP_000887629.1.14538 WP_000887629.1.14581 WP_000887629.1.14582 WP_000887629.1.14600 WP_000887629.1.14601 WP_000887629.1.14605 WP_000887629.1.14607 WP_000887629.1.1461 WP_000887629.1.14621 WP_000887629.1.14648 WP_000887629.1.14661 WP_000887629.1.14672 WP_000887629.1.14678 WP_000887629.1.14687 WP_000887629.1.14693 WP_000887629.1.14711 WP_000887629.1.14712 WP_000887629.1.14748 WP_000887629.1.14811 WP_000887629.1.14833 WP_000887629.1.1486 WP_000887629.1.14861 WP_000887629.1.14871 WP_000887629.1.14879 WP_000887629.1.14914 WP_000887629.1.14956 WP_000887629.1.14958 WP_000887629.1.14963 WP_000887629.1.14965 WP_000887629.1.14977 WP_000887629.1.14992 WP_000887629.1.14993 WP_000887629.1.15007 WP_000887629.1.15020 WP_000887629.1.15041 WP_000887629.1.15087 WP_000887629.1.1510 WP_000887629.1.15117 WP_000887629.1.1512 WP_000887629.1.15121 WP_000887629.1.15138 WP_000887629.1.15148 WP_000887629.1.15191 WP_000887629.1.15193 WP_000887629.1.15207 WP_000887629.1.15221 WP_000887629.1.1524 WP_000887629.1.15245 WP_000887629.1.15252 WP_000887629.1.15259 WP_000887629.1.15270 WP_000887629.1.15277 WP_000887629.1.15282 WP_000887629.1.15287 WP_000887629.1.153 WP_000887629.1.15300 WP_000887629.1.15304 WP_000887629.1.15335 WP_000887629.1.15356 WP_000887629.1.15377 WP_000887629.1.15416 WP_000887629.1.15420 WP_000887629.1.1543 WP_000887629.1.15444 WP_000887629.1.15453 WP_000887629.1.15464 WP_000887629.1.15469 WP_000887629.1.15496 WP_000887629.1.1550 WP_000887629.1.15503 WP_000887629.1.15521 WP_000887629.1.15527 WP_000887629.1.15528 WP_000887629.1.15565 WP_000887629.1.15576 WP_000887629.1.15583 WP_000887629.1.1559 WP_000887629.1.15593 WP_000887629.1.15600 WP_000887629.1.1561 WP_000887629.1.15620 WP_000887629.1.15626 WP_000887629.1.15645 WP_000887629.1.15654 WP_000887629.1.15702 WP_000887629.1.15707 WP_000887629.1.15731 WP_000887629.1.15740 WP_000887629.1.15747 WP_000887629.1.15752 WP_000887629.1.15762 WP_000887629.1.15767 WP_000887629.1.15768 WP_000887629.1.15771 WP_000887629.1.15782 WP_000887629.1.15791 WP_000887629.1.1580 WP_000887629.1.15809 WP_000887629.1.1582 WP_000887629.1.15857 WP_000887629.1.15863 WP_000887629.1.1588 WP_000887629.1.15894 WP_000887629.1.15906 WP_000887629.1.15916 WP_000887629.1.15945 WP_000887629.1.15983 WP_000887629.1.15984 WP_000887629.1.15990 WP_000887629.1.16014 WP_000887629.1.16015 WP_000887629.1.1604 WP_000887629.1.16042 WP_000887629.1.16067 WP_000887629.1.16075 WP_000887629.1.16086 WP_000887629.1.16087 WP_000887629.1.1609 WP_000887629.1.16102 WP_000887629.1.16111 WP_000887629.1.16131 WP_000887629.1.16133 WP_000887629.1.16154 WP_000887629.1.16171 WP_000887629.1.16175 WP_000887629.1.16179 WP_000887629.1.16183 WP_000887629.1.16188 WP_000887629.1.16194 WP_000887629.1.1621 WP_000887629.1.1622 WP_000887629.1.16222 WP_000887629.1.16270 WP_000887629.1.16272 WP_000887629.1.16294 WP_000887629.1.163 WP_000887629.1.16303 WP_000887629.1.16388 WP_000887629.1.16396 WP_000887629.1.16463 WP_000887629.1.16481 WP_000887629.1.16482 WP_000887629.1.16500 WP_000887629.1.16517 WP_000887629.1.16532 WP_000887629.1.16539 WP_000887629.1.16541 WP_000887629.1.1655 WP_000887629.1.16577 WP_000887629.1.16592 WP_000887629.1.16604 WP_000887629.1.16612 WP_000887629.1.16640 WP_000887629.1.16648 WP_000887629.1.16669 WP_000887629.1.16682 WP_000887629.1.16715 WP_000887629.1.16721 WP_000887629.1.1673 WP_000887629.1.16745 WP_000887629.1.16752 WP_000887629.1.16780 WP_000887629.1.16798 WP_000887629.1.16799 WP_000887629.1.16805 WP_000887629.1.16807 WP_000887629.1.16845 WP_000887629.1.16861 WP_000887629.1.16894 WP_000887629.1.16927 WP_000887629.1.16970 WP_000887629.1.16992 WP_000887629.1.17014 WP_000887629.1.17018 WP_000887629.1.17042 WP_000887629.1.17061 WP_000887629.1.17084 WP_000887629.1.17085 WP_000887629.1.17087 WP_000887629.1.17089 WP_000887629.1.1710 WP_000887629.1.17101 WP_000887629.1.17102 WP_000887629.1.17109 WP_000887629.1.17111 WP_000887629.1.17114 WP_000887629.1.17119 WP_000887629.1.17123 WP_000887629.1.17150 WP_000887629.1.17153 WP_000887629.1.17170 WP_000887629.1.17172 WP_000887629.1.17182 WP_000887629.1.17187 WP_000887629.1.17205 WP_000887629.1.17206 WP_000887629.1.17216 WP_000887629.1.17230 WP_000887629.1.17241 WP_000887629.1.17242 WP_000887629.1.1726 WP_000887629.1.17282 WP_000887629.1.17290 WP_000887629.1.17297 WP_000887629.1.17300 WP_000887629.1.17301 WP_000887629.1.1731 WP_000887629.1.17356 WP_000887629.1.17360 WP_000887629.1.17373 WP_000887629.1.17386 WP_000887629.1.17389 WP_000887629.1.17392 WP_000887629.1.17403 WP_000887629.1.17410 WP_000887629.1.17415 WP_000887629.1.17417 WP_000887629.1.17432 WP_000887629.1.17441 WP_000887629.1.17464 WP_000887629.1.17496 WP_000887629.1.17515 WP_000887629.1.1754 WP_000887629.1.1755 WP_000887629.1.17550 WP_000887629.1.17570 WP_000887629.1.17577 WP_000887629.1.17584 WP_000887629.1.17595 WP_000887629.1.17623 WP_000887629.1.1763 WP_000887629.1.17637 WP_000887629.1.1766 WP_000887629.1.1769 WP_000887629.1.17734 WP_000887629.1.17757 WP_000887629.1.17765 WP_000887629.1.17766 WP_000887629.1.1778 WP_000887629.1.17802 WP_000887629.1.17829 WP_000887629.1.17831 WP_000887629.1.17836 WP_000887629.1.17889 WP_000887629.1.17904 WP_000887629.1.17920 WP_000887629.1.17925 WP_000887629.1.17937 WP_000887629.1.17961 WP_000887629.1.17963 WP_000887629.1.17984 WP_000887629.1.18006 WP_000887629.1.1802 WP_000887629.1.18024 WP_000887629.1.18064 WP_000887629.1.18094 WP_000887629.1.18112 WP_000887629.1.18133 WP_000887629.1.18134 WP_000887629.1.18136 WP_000887629.1.18141 WP_000887629.1.18164 WP_000887629.1.18175 WP_000887629.1.1821 WP_000887629.1.18225 WP_000887629.1.18275 WP_000887629.1.18311 WP_000887629.1.18316 WP_000887629.1.18326 WP_000887629.1.18338 WP_000887629.1.1834 WP_000887629.1.18340 WP_000887629.1.18348 WP_000887629.1.18354 WP_000887629.1.18381 WP_000887629.1.18394 WP_000887629.1.18420 WP_000887629.1.18436 WP_000887629.1.18438 WP_000887629.1.1844 WP_000887629.1.18458 WP_000887629.1.18461 WP_000887629.1.18482 WP_000887629.1.18511 WP_000887629.1.18519 WP_000887629.1.18530 WP_000887629.1.18550 WP_000887629.1.18556 WP_000887629.1.18581 WP_000887629.1.18583 WP_000887629.1.18588 WP_000887629.1.1862 WP_000887629.1.18628 WP_000887629.1.18650 WP_000887629.1.18651 WP_000887629.1.1866 WP_000887629.1.18666 WP_000887629.1.18675 WP_000887629.1.18699 WP_000887629.1.18714 WP_000887629.1.18725 WP_000887629.1.18726 WP_000887629.1.18734 WP_000887629.1.188 WP_000887629.1.18801 WP_000887629.1.18806 WP_000887629.1.18837 WP_000887629.1.18858 WP_000887629.1.18861 WP_000887629.1.18874 WP_000887629.1.18876 WP_000887629.1.18899 WP_000887629.1.18923 WP_000887629.1.18929 WP_000887629.1.18936 WP_000887629.1.1896 WP_000887629.1.18966 WP_000887629.1.18983 WP_000887629.1.18995 WP_000887629.1.1903 WP_000887629.1.19039 WP_000887629.1.1906 WP_000887629.1.19075 WP_000887629.1.1909 WP_000887629.1.19090 WP_000887629.1.191 WP_000887629.1.19100 WP_000887629.1.19113 WP_000887629.1.19114 WP_000887629.1.19122 WP_000887629.1.19129 WP_000887629.1.19146 WP_000887629.1.19147 WP_000887629.1.1915 WP_000887629.1.19150 WP_000887629.1.19153 WP_000887629.1.19194 WP_000887629.1.19205 WP_000887629.1.19206 WP_000887629.1.1925 WP_000887629.1.19277 WP_000887629.1.19297 WP_000887629.1.193 WP_000887629.1.19312 WP_000887629.1.19313 WP_000887629.1.19314 WP_000887629.1.19332 WP_000887629.1.19338 WP_000887629.1.19347 WP_000887629.1.19350 WP_000887629.1.19361 WP_000887629.1.19374 WP_000887629.1.19379 WP_000887629.1.19389 WP_000887629.1.19397 WP_000887629.1.19419 WP_000887629.1.19424 WP_000887629.1.19448 WP_000887629.1.19478 WP_000887629.1.19487 WP_000887629.1.19492 WP_000887629.1.19494 WP_000887629.1.19544 WP_000887629.1.19547 WP_000887629.1.19557 WP_000887629.1.19581 WP_000887629.1.19583 WP_000887629.1.19593 WP_000887629.1.19602 WP_000887629.1.1963 WP_000887629.1.19644 WP_000887629.1.19649 WP_000887629.1.19661 WP_000887629.1.19691 WP_000887629.1.19758 WP_000887629.1.19760 WP_000887629.1.19778 WP_000887629.1.19795 WP_000887629.1.1982 WP_000887629.1.19838 WP_000887629.1.19840 WP_000887629.1.19845 WP_000887629.1.1987 WP_000887629.1.19873 WP_000887629.1.19878 WP_000887629.1.19889 WP_000887629.1.19940 WP_000887629.1.19945 WP_000887629.1.19994 WP_000887629.1.20025 WP_000887629.1.2005 WP_000887629.1.20096 WP_000887629.1.20114 WP_000887629.1.20129 WP_000887629.1.2015 WP_000887629.1.20151 WP_000887629.1.20157 WP_000887629.1.20159 WP_000887629.1.20164 WP_000887629.1.20166 WP_000887629.1.20170 WP_000887629.1.20178 WP_000887629.1.20183 WP_000887629.1.20192 WP_000887629.1.20215 WP_000887629.1.2022 WP_000887629.1.20224 WP_000887629.1.20230 WP_000887629.1.20238 WP_000887629.1.20251 WP_000887629.1.20264 WP_000887629.1.2027 WP_000887629.1.20289 WP_000887629.1.20290 WP_000887629.1.20308 WP_000887629.1.20318 WP_000887629.1.20325 WP_000887629.1.20331 WP_000887629.1.20334 WP_000887629.1.20370 WP_000887629.1.20388 WP_000887629.1.20445 WP_000887629.1.20449 WP_000887629.1.20483 WP_000887629.1.20506 WP_000887629.1.20515 WP_000887629.1.20519 WP_000887629.1.20536 WP_000887629.1.20549 WP_000887629.1.20596 WP_000887629.1.20609 WP_000887629.1.2063 WP_000887629.1.20630 WP_000887629.1.20636 WP_000887629.1.20638 WP_000887629.1.20640 WP_000887629.1.20662 WP_000887629.1.20668 WP_000887629.1.20691 WP_000887629.1.20709 WP_000887629.1.20724 WP_000887629.1.20730 WP_000887629.1.20737 WP_000887629.1.20741 WP_000887629.1.20745 WP_000887629.1.20761 WP_000887629.1.20784 WP_000887629.1.20785 WP_000887629.1.20818 WP_000887629.1.20824 WP_000887629.1.20831 WP_000887629.1.20848 WP_000887629.1.20863 WP_000887629.1.20893 WP_000887629.1.20907 WP_000887629.1.2092 WP_000887629.1.2093 WP_000887629.1.20933 WP_000887629.1.2094 WP_000887629.1.20941 WP_000887629.1.20943 WP_000887629.1.20950 WP_000887629.1.20958 WP_000887629.1.20982 WP_000887629.1.20989 WP_000887629.1.2100 WP_000887629.1.21017 WP_000887629.1.21020 WP_000887629.1.21022 WP_000887629.1.21024 WP_000887629.1.21029 WP_000887629.1.21033 WP_000887629.1.21041 WP_000887629.1.21057 WP_000887629.1.21059 WP_000887629.1.21104 WP_000887629.1.21122 WP_000887629.1.21129 WP_000887629.1.2113 WP_000887629.1.21131 WP_000887629.1.21137 WP_000887629.1.21152 WP_000887629.1.21171 WP_000887629.1.21197 WP_000887629.1.21236 WP_000887629.1.21248 WP_000887629.1.21251 WP_000887629.1.21266 WP_000887629.1.21277 WP_000887629.1.21305 WP_000887629.1.21336 WP_000887629.1.21378 WP_000887629.1.21395 WP_000887629.1.2142 WP_000887629.1.21441 WP_000887629.1.21450 WP_000887629.1.21455 WP_000887629.1.21470 WP_000887629.1.21508 WP_000887629.1.21519 WP_000887629.1.21537 WP_000887629.1.2156 WP_000887629.1.21573 WP_000887629.1.21578 WP_000887629.1.21596 WP_000887629.1.21628 WP_000887629.1.21634 WP_000887629.1.21637 WP_000887629.1.2164 WP_000887629.1.21656 WP_000887629.1.21661 WP_000887629.1.21666 WP_000887629.1.21667 WP_000887629.1.21668 WP_000887629.1.21673 WP_000887629.1.21696 WP_000887629.1.21714 WP_000887629.1.21727 WP_000887629.1.21732 WP_000887629.1.21733 WP_000887629.1.21756 WP_000887629.1.21758 WP_000887629.1.21762 WP_000887629.1.21771 WP_000887629.1.21773 WP_000887629.1.21811 WP_000887629.1.21812 WP_000887629.1.21823 WP_000887629.1.21887 WP_000887629.1.21915 WP_000887629.1.21945 WP_000887629.1.21948 WP_000887629.1.21962 WP_000887629.1.21986 WP_000887629.1.22021 WP_000887629.1.22060 WP_000887629.1.22113 WP_000887629.1.22138 WP_000887629.1.22161 WP_000887629.1.2218 WP_000887629.1.22182 WP_000887629.1.22189 WP_000887629.1.22195 WP_000887629.1.22203 WP_000887629.1.22204 WP_000887629.1.22251 WP_000887629.1.22268 WP_000887629.1.22269 WP_000887629.1.22272 WP_000887629.1.22280 WP_000887629.1.22291 WP_000887629.1.22295 WP_000887629.1.22304 WP_000887629.1.22314 WP_000887629.1.22325 WP_000887629.1.22350 WP_000887629.1.22359 WP_000887629.1.22363 WP_000887629.1.22381 WP_000887629.1.2242 WP_000887629.1.22431 WP_000887629.1.2245 WP_000887629.1.22450 WP_000887629.1.22464 WP_000887629.1.22470 WP_000887629.1.22494 WP_000887629.1.22501 WP_000887629.1.22508 WP_000887629.1.22544 WP_000887629.1.22549 WP_000887629.1.22571 WP_000887629.1.22572 WP_000887629.1.22574 WP_000887629.1.22576 WP_000887629.1.22579 WP_000887629.1.22594 WP_000887629.1.22599 WP_000887629.1.22631 WP_000887629.1.22632 WP_000887629.1.22641 WP_000887629.1.22669 WP_000887629.1.22685 WP_000887629.1.22690 WP_000887629.1.22743 WP_000887629.1.22756 WP_000887629.1.22757 WP_000887629.1.22759 WP_000887629.1.22765 WP_000887629.1.22777 WP_000887629.1.22809 WP_000887629.1.22824 WP_000887629.1.22827 WP_000887629.1.22830 WP_000887629.1.22846 WP_000887629.1.22868 WP_000887629.1.22875 WP_000887629.1.22878 WP_000887629.1.22885 WP_000887629.1.22908 WP_000887629.1.22917 WP_000887629.1.22925 WP_000887629.1.22939 WP_000887629.1.22961 WP_000887629.1.22990 WP_000887629.1.22993 WP_000887629.1.2300 WP_000887629.1.23005 WP_000887629.1.23026 WP_000887629.1.23035 WP_000887629.1.23042 WP_000887629.1.23044 WP_000887629.1.23045 WP_000887629.1.23057 WP_000887629.1.23062 WP_000887629.1.23073 WP_000887629.1.23078 WP_000887629.1.23081 WP_000887629.1.23090 WP_000887629.1.23092 WP_000887629.1.23105 WP_000887629.1.23109 WP_000887629.1.23115 WP_000887629.1.23120 WP_000887629.1.23135 WP_000887629.1.2322 WP_000887629.1.23230 WP_000887629.1.23241 WP_000887629.1.2325 WP_000887629.1.23257 WP_000887629.1.23270 WP_000887629.1.23285 WP_000887629.1.23290 WP_000887629.1.23293 WP_000887629.1.23323 WP_000887629.1.23330 WP_000887629.1.23352 WP_000887629.1.23376 WP_000887629.1.23378 WP_000887629.1.23383 WP_000887629.1.23388 WP_000887629.1.23393 WP_000887629.1.23435 WP_000887629.1.23443 WP_000887629.1.23456 WP_000887629.1.23463 WP_000887629.1.23467 WP_000887629.1.23486 WP_000887629.1.23487 WP_000887629.1.23511 WP_000887629.1.23520 WP_000887629.1.23522 WP_000887629.1.23527 WP_000887629.1.2353 WP_000887629.1.23549 WP_000887629.1.23554 WP_000887629.1.23561 WP_000887629.1.23563 WP_000887629.1.23575 WP_000887629.1.23584 WP_000887629.1.23593 WP_000887629.1.2362 WP_000887629.1.23640 WP_000887629.1.23660 WP_000887629.1.23676 WP_000887629.1.23686 WP_000887629.1.23693 WP_000887629.1.23711 WP_000887629.1.23724 WP_000887629.1.23729 WP_000887629.1.23741 WP_000887629.1.23754 WP_000887629.1.23765 WP_000887629.1.23790 WP_000887629.1.23795 WP_000887629.1.23804 WP_000887629.1.23806 WP_000887629.1.23812 WP_000887629.1.23838 WP_000887629.1.23840 WP_000887629.1.23855 WP_000887629.1.2388 WP_000887629.1.23881 WP_000887629.1.23886 WP_000887629.1.23890 WP_000887629.1.23895 WP_000887629.1.23898 WP_000887629.1.23899 WP_000887629.1.23914 WP_000887629.1.23915 WP_000887629.1.23931 WP_000887629.1.23945 WP_000887629.1.23950 WP_000887629.1.23960 WP_000887629.1.23962 WP_000887629.1.23970 WP_000887629.1.23971 WP_000887629.1.23973 WP_000887629.1.23984 WP_000887629.1.23985 WP_000887629.1.24 WP_000887629.1.24024 WP_000887629.1.24038 WP_000887629.1.24045 WP_000887629.1.24051 WP_000887629.1.24058 WP_000887629.1.24068 WP_000887629.1.24070 WP_000887629.1.24088 WP_000887629.1.24089 WP_000887629.1.24120 WP_000887629.1.24124 WP_000887629.1.24127 WP_000887629.1.24136 WP_000887629.1.24169 WP_000887629.1.2418 WP_000887629.1.24194 WP_000887629.1.24233 WP_000887629.1.24278 WP_000887629.1.2428 WP_000887629.1.24283 WP_000887629.1.24290 WP_000887629.1.24304 WP_000887629.1.24316 WP_000887629.1.24362 WP_000887629.1.2437 WP_000887629.1.24374 WP_000887629.1.24381 WP_000887629.1.24383 WP_000887629.1.24458 WP_000887629.1.24460 WP_000887629.1.24473 WP_000887629.1.24483 WP_000887629.1.24485 WP_000887629.1.2449 WP_000887629.1.24499 WP_000887629.1.24523 WP_000887629.1.24524 WP_000887629.1.24533 WP_000887629.1.24536 WP_000887629.1.2456 WP_000887629.1.24560 WP_000887629.1.24570 WP_000887629.1.24575 WP_000887629.1.24583 WP_000887629.1.24592 WP_000887629.1.24616 WP_000887629.1.24634 WP_000887629.1.24641 WP_000887629.1.24642 WP_000887629.1.24646 WP_000887629.1.24650 WP_000887629.1.24693 WP_000887629.1.24695 WP_000887629.1.24703 WP_000887629.1.24752 WP_000887629.1.24753 WP_000887629.1.24763 WP_000887629.1.24773 WP_000887629.1.24783 WP_000887629.1.2479 WP_000887629.1.24791 WP_000887629.1.24799 WP_000887629.1.24808 WP_000887629.1.24849 WP_000887629.1.24854 WP_000887629.1.24870 WP_000887629.1.24876 WP_000887629.1.24899 WP_000887629.1.24906 WP_000887629.1.24929 WP_000887629.1.24939 WP_000887629.1.24946 WP_000887629.1.24968 WP_000887629.1.24979 WP_000887629.1.24981 WP_000887629.1.24982 WP_000887629.1.24984 WP_000887629.1.25019 WP_000887629.1.2502 WP_000887629.1.25021 WP_000887629.1.25039 WP_000887629.1.2504 WP_000887629.1.25042 WP_000887629.1.25050 WP_000887629.1.25060 WP_000887629.1.25076 WP_000887629.1.25079 WP_000887629.1.25082 WP_000887629.1.25085 WP_000887629.1.25086 WP_000887629.1.25087 WP_000887629.1.25088 WP_000887629.1.25126 WP_000887629.1.25141 WP_000887629.1.25174 WP_000887629.1.25183 WP_000887629.1.25201 WP_000887629.1.25203 WP_000887629.1.25248 WP_000887629.1.25270 WP_000887629.1.25272 WP_000887629.1.25289 WP_000887629.1.25305 WP_000887629.1.25312 WP_000887629.1.25324 WP_000887629.1.25346 WP_000887629.1.2537 WP_000887629.1.25378 WP_000887629.1.25380 WP_000887629.1.254 WP_000887629.1.2540 WP_000887629.1.25403 WP_000887629.1.25414 WP_000887629.1.25420 WP_000887629.1.2543 WP_000887629.1.25446 WP_000887629.1.25480 WP_000887629.1.255 WP_000887629.1.25517 WP_000887629.1.25525 WP_000887629.1.25526 WP_000887629.1.25548 WP_000887629.1.25577 WP_000887629.1.2558 WP_000887629.1.25592 WP_000887629.1.25598 WP_000887629.1.25602 WP_000887629.1.25613 WP_000887629.1.25631 WP_000887629.1.25643 WP_000887629.1.25652 WP_000887629.1.2567 WP_000887629.1.25681 WP_000887629.1.25701 WP_000887629.1.25712 WP_000887629.1.25713 WP_000887629.1.25717 WP_000887629.1.25718 WP_000887629.1.25726 WP_000887629.1.25753 WP_000887629.1.25755 WP_000887629.1.25794 WP_000887629.1.25819 WP_000887629.1.25831 WP_000887629.1.25832 WP_000887629.1.25843 WP_000887629.1.25855 WP_000887629.1.25869 WP_000887629.1.25873 WP_000887629.1.2588 WP_000887629.1.25886 WP_000887629.1.2589 WP_000887629.1.25895 WP_000887629.1.25915 WP_000887629.1.2597 WP_000887629.1.25996 WP_000887629.1.26040 WP_000887629.1.26048 WP_000887629.1.26055 WP_000887629.1.2606 WP_000887629.1.26061 WP_000887629.1.26066 WP_000887629.1.26076 WP_000887629.1.26092 WP_000887629.1.26100 WP_000887629.1.26105 WP_000887629.1.2612 WP_000887629.1.26121 WP_000887629.1.26125 WP_000887629.1.26130 WP_000887629.1.26131 WP_000887629.1.26134 WP_000887629.1.26135 WP_000887629.1.26150 WP_000887629.1.26161 WP_000887629.1.26175 WP_000887629.1.26186 WP_000887629.1.26189 WP_000887629.1.26191 WP_000887629.1.26246 WP_000887629.1.26264 WP_000887629.1.26270 WP_000887629.1.26304 WP_000887629.1.26325 WP_000887629.1.26331 WP_000887629.1.2637 WP_000887629.1.26379 WP_000887629.1.26391 WP_000887629.1.26401 WP_000887629.1.26419 WP_000887629.1.2642 WP_000887629.1.26438 WP_000887629.1.26443 WP_000887629.1.26467 WP_000887629.1.26474 WP_000887629.1.26479 WP_000887629.1.26480 WP_000887629.1.26525 WP_000887629.1.26570 WP_000887629.1.26574 WP_000887629.1.26575 WP_000887629.1.26588 WP_000887629.1.26590 WP_000887629.1.26598 WP_000887629.1.26609 WP_000887629.1.26613 WP_000887629.1.26627 WP_000887629.1.26644 WP_000887629.1.26658 WP_000887629.1.26659 WP_000887629.1.26660 WP_000887629.1.26683 WP_000887629.1.26688 WP_000887629.1.26716 WP_000887629.1.26720 WP_000887629.1.26736 WP_000887629.1.26761 WP_000887629.1.26782 WP_000887629.1.26878 WP_000887629.1.2688 WP_000887629.1.26912 WP_000887629.1.26932 WP_000887629.1.26941 WP_000887629.1.2695 WP_000887629.1.26950 WP_000887629.1.26975 WP_000887629.1.26987 WP_000887629.1.26995 WP_000887629.1.26998 WP_000887629.1.27019 WP_000887629.1.27043 WP_000887629.1.27057 WP_000887629.1.27060 WP_000887629.1.27091 WP_000887629.1.27098 WP_000887629.1.27105 WP_000887629.1.27134 WP_000887629.1.27141 WP_000887629.1.27148 WP_000887629.1.27175 WP_000887629.1.27188 WP_000887629.1.27214 WP_000887629.1.27234 WP_000887629.1.27260 WP_000887629.1.27280 WP_000887629.1.27283 WP_000887629.1.27287 WP_000887629.1.27292 WP_000887629.1.2731 WP_000887629.1.27310 WP_000887629.1.27330 WP_000887629.1.27338 WP_000887629.1.27367 WP_000887629.1.27401 WP_000887629.1.27424 WP_000887629.1.27426 WP_000887629.1.27445 WP_000887629.1.27451 WP_000887629.1.27504 WP_000887629.1.27518 WP_000887629.1.27520 WP_000887629.1.27524 WP_000887629.1.2755 WP_000887629.1.27560 WP_000887629.1.27580 WP_000887629.1.27683 WP_000887629.1.27691 WP_000887629.1.27698 WP_000887629.1.27723 WP_000887629.1.27734 WP_000887629.1.27741 WP_000887629.1.27742 WP_000887629.1.27749 WP_000887629.1.27758 WP_000887629.1.27774 WP_000887629.1.27786 WP_000887629.1.27797 WP_000887629.1.27856 WP_000887629.1.27861 WP_000887629.1.27876 WP_000887629.1.27879 WP_000887629.1.27897 WP_000887629.1.27913 WP_000887629.1.27923 WP_000887629.1.27932 WP_000887629.1.2794 WP_000887629.1.27971 WP_000887629.1.27998 WP_000887629.1.28008 WP_000887629.1.28026 WP_000887629.1.28027 WP_000887629.1.28046 WP_000887629.1.28051 WP_000887629.1.28109 WP_000887629.1.28110 WP_000887629.1.28156 WP_000887629.1.28168 WP_000887629.1.28199 WP_000887629.1.2823 WP_000887629.1.28250 WP_000887629.1.2826 WP_000887629.1.28268 WP_000887629.1.28271 WP_000887629.1.28305 WP_000887629.1.28318 WP_000887629.1.28349 WP_000887629.1.28371 WP_000887629.1.2838 WP_000887629.1.28401 WP_000887629.1.28414 WP_000887629.1.28433 WP_000887629.1.28440 WP_000887629.1.28461 WP_000887629.1.28476 WP_000887629.1.28480 WP_000887629.1.28496 WP_000887629.1.285 WP_000887629.1.28500 WP_000887629.1.28536 WP_000887629.1.28540 WP_000887629.1.28551 WP_000887629.1.2866 WP_000887629.1.28662 WP_000887629.1.28683 WP_000887629.1.28697 WP_000887629.1.28711 WP_000887629.1.28742 WP_000887629.1.28760 WP_000887629.1.28762 WP_000887629.1.28769 WP_000887629.1.28791 WP_000887629.1.28809 WP_000887629.1.2881 WP_000887629.1.28829 WP_000887629.1.28835 WP_000887629.1.28842 WP_000887629.1.28863 WP_000887629.1.28879 WP_000887629.1.28919 WP_000887629.1.28950 WP_000887629.1.28953 WP_000887629.1.28982 WP_000887629.1.28994 WP_000887629.1.290 WP_000887629.1.29001 WP_000887629.1.29016 WP_000887629.1.29049 WP_000887629.1.29055 WP_000887629.1.29061 WP_000887629.1.29079 WP_000887629.1.29082 WP_000887629.1.291 WP_000887629.1.29100 WP_000887629.1.29118 WP_000887629.1.29125 WP_000887629.1.29126 WP_000887629.1.29128 WP_000887629.1.29146 WP_000887629.1.29150 WP_000887629.1.29164 WP_000887629.1.29176 WP_000887629.1.29194 WP_000887629.1.29197 WP_000887629.1.29202 WP_000887629.1.29206 WP_000887629.1.29221 WP_000887629.1.29230 WP_000887629.1.29239 WP_000887629.1.29252 WP_000887629.1.2926 WP_000887629.1.29377 WP_000887629.1.29394 WP_000887629.1.29404 WP_000887629.1.2942 WP_000887629.1.29429 WP_000887629.1.29443 WP_000887629.1.2945 WP_000887629.1.29503 WP_000887629.1.29504 WP_000887629.1.29513 WP_000887629.1.2952 WP_000887629.1.2954 WP_000887629.1.29556 WP_000887629.1.29564 WP_000887629.1.29590 WP_000887629.1.29597 WP_000887629.1.29603 WP_000887629.1.29618 WP_000887629.1.29643 WP_000887629.1.29662 WP_000887629.1.29669 WP_000887629.1.29689 WP_000887629.1.29715 WP_000887629.1.29724 WP_000887629.1.29740 WP_000887629.1.29746 WP_000887629.1.29752 WP_000887629.1.2978 WP_000887629.1.29798 WP_000887629.1.29812 WP_000887629.1.29818 WP_000887629.1.29820 WP_000887629.1.29840 WP_000887629.1.2986 WP_000887629.1.29874 WP_000887629.1.29876 WP_000887629.1.29933 WP_000887629.1.2995 WP_000887629.1.29967 WP_000887629.1.29979 WP_000887629.1.29992 WP_000887629.1.30 WP_000887629.1.30004 WP_000887629.1.30016 WP_000887629.1.30019 WP_000887629.1.30035 WP_000887629.1.30052 WP_000887629.1.30063 WP_000887629.1.30064 WP_000887629.1.30098 WP_000887629.1.30105 WP_000887629.1.30123 WP_000887629.1.30141 WP_000887629.1.30164 WP_000887629.1.3018 WP_000887629.1.30221 WP_000887629.1.30231 WP_000887629.1.30239 WP_000887629.1.30247 WP_000887629.1.30253 WP_000887629.1.30269 WP_000887629.1.30298 WP_000887629.1.30391 WP_000887629.1.30401 WP_000887629.1.30428 WP_000887629.1.3045 WP_000887629.1.30452 WP_000887629.1.30472 WP_000887629.1.30476 WP_000887629.1.30479 WP_000887629.1.30497 WP_000887629.1.30524 WP_000887629.1.30536 WP_000887629.1.30546 WP_000887629.1.3055 WP_000887629.1.30554 WP_000887629.1.30570 WP_000887629.1.30580 WP_000887629.1.3063 WP_000887629.1.30630 WP_000887629.1.30637 WP_000887629.1.30639 WP_000887629.1.30665 WP_000887629.1.30700 WP_000887629.1.30733 WP_000887629.1.30742 WP_000887629.1.30749 WP_000887629.1.30783 WP_000887629.1.30808 WP_000887629.1.3083 WP_000887629.1.30843 WP_000887629.1.30853 WP_000887629.1.30866 WP_000887629.1.30867 WP_000887629.1.30879 WP_000887629.1.30887 WP_000887629.1.30896 WP_000887629.1.30905 WP_000887629.1.30906 WP_000887629.1.30918 WP_000887629.1.30960 WP_000887629.1.30993 WP_000887629.1.30999 WP_000887629.1.31000 WP_000887629.1.31009 WP_000887629.1.31017 WP_000887629.1.31026 WP_000887629.1.31055 WP_000887629.1.31089 WP_000887629.1.31142 WP_000887629.1.31154 WP_000887629.1.312 WP_000887629.1.31211 WP_000887629.1.31252 WP_000887629.1.31295 WP_000887629.1.31319 WP_000887629.1.31340 WP_000887629.1.31347 WP_000887629.1.31353 WP_000887629.1.31357 WP_000887629.1.31379 WP_000887629.1.3140 WP_000887629.1.31401 WP_000887629.1.31407 WP_000887629.1.31419 WP_000887629.1.31421 WP_000887629.1.31422 WP_000887629.1.31429 WP_000887629.1.31431 WP_000887629.1.31434 WP_000887629.1.3147 WP_000887629.1.31482 WP_000887629.1.31506 WP_000887629.1.31511 WP_000887629.1.31518 WP_000887629.1.31521 WP_000887629.1.31527 WP_000887629.1.31557 WP_000887629.1.31559 WP_000887629.1.31575 WP_000887629.1.31614 WP_000887629.1.31618 WP_000887629.1.31625 WP_000887629.1.31639 WP_000887629.1.31679 WP_000887629.1.31681 WP_000887629.1.3169 WP_000887629.1.31696 WP_000887629.1.31709 WP_000887629.1.31736 WP_000887629.1.31740 WP_000887629.1.31801 WP_000887629.1.31803 WP_000887629.1.3181 WP_000887629.1.31823 WP_000887629.1.31825 WP_000887629.1.31833 WP_000887629.1.31835 WP_000887629.1.31839 WP_000887629.1.31860 WP_000887629.1.31863 WP_000887629.1.31866 WP_000887629.1.31898 WP_000887629.1.31899 WP_000887629.1.31903 WP_000887629.1.31924 WP_000887629.1.3193 WP_000887629.1.31937 WP_000887629.1.31956 WP_000887629.1.31978 WP_000887629.1.3201 WP_000887629.1.32020 WP_000887629.1.32021 WP_000887629.1.32030 WP_000887629.1.32037 WP_000887629.1.32049 WP_000887629.1.32063 WP_000887629.1.32078 WP_000887629.1.32089 WP_000887629.1.32091 WP_000887629.1.32093 WP_000887629.1.32094 WP_000887629.1.3212 WP_000887629.1.32121 WP_000887629.1.32127 WP_000887629.1.32138 WP_000887629.1.32142 WP_000887629.1.32143 WP_000887629.1.3215 WP_000887629.1.32173 WP_000887629.1.32184 WP_000887629.1.322 WP_000887629.1.32222 WP_000887629.1.32232 WP_000887629.1.32234 WP_000887629.1.32242 WP_000887629.1.32243 WP_000887629.1.32279 WP_000887629.1.32287 WP_000887629.1.3233 WP_000887629.1.32333 WP_000887629.1.32394 WP_000887629.1.32406 WP_000887629.1.32432 WP_000887629.1.32435 WP_000887629.1.32443 WP_000887629.1.3247 WP_000887629.1.32475 WP_000887629.1.32479 WP_000887629.1.3248 WP_000887629.1.32480 WP_000887629.1.32494 WP_000887629.1.32509 WP_000887629.1.32518 WP_000887629.1.32536 WP_000887629.1.32558 WP_000887629.1.32561 WP_000887629.1.32574 WP_000887629.1.32580 WP_000887629.1.3259 WP_000887629.1.32590 WP_000887629.1.32591 WP_000887629.1.32601 WP_000887629.1.32635 WP_000887629.1.32655 WP_000887629.1.32661 WP_000887629.1.32680 WP_000887629.1.327 WP_000887629.1.32709 WP_000887629.1.32715 WP_000887629.1.32718 WP_000887629.1.32720 WP_000887629.1.32722 WP_000887629.1.32724 WP_000887629.1.32741 WP_000887629.1.32772 WP_000887629.1.32811 WP_000887629.1.32815 WP_000887629.1.32831 WP_000887629.1.32835 WP_000887629.1.32875 WP_000887629.1.32888 WP_000887629.1.32903 WP_000887629.1.32910 WP_000887629.1.32931 WP_000887629.1.32946 WP_000887629.1.3295 WP_000887629.1.32959 WP_000887629.1.32972 WP_000887629.1.32984 WP_000887629.1.32992 WP_000887629.1.32995 WP_000887629.1.33014 WP_000887629.1.33022 WP_000887629.1.33046 WP_000887629.1.33049 WP_000887629.1.33053 WP_000887629.1.33055 WP_000887629.1.33094 WP_000887629.1.33119 WP_000887629.1.33146 WP_000887629.1.33167 WP_000887629.1.33171 WP_000887629.1.33178 WP_000887629.1.33179 WP_000887629.1.33217 WP_000887629.1.3323 WP_000887629.1.33237 WP_000887629.1.33238 WP_000887629.1.33244 WP_000887629.1.33268 WP_000887629.1.33303 WP_000887629.1.33325 WP_000887629.1.33341 WP_000887629.1.33362 WP_000887629.1.334 WP_000887629.1.33408 WP_000887629.1.33410 WP_000887629.1.33413 WP_000887629.1.33422 WP_000887629.1.33424 WP_000887629.1.3344 WP_000887629.1.33475 WP_000887629.1.33476 WP_000887629.1.33502 WP_000887629.1.33512 WP_000887629.1.33525 WP_000887629.1.33526 WP_000887629.1.3354 WP_000887629.1.33545 WP_000887629.1.33561 WP_000887629.1.33563 WP_000887629.1.33565 WP_000887629.1.33584 WP_000887629.1.33595 WP_000887629.1.33631 WP_000887629.1.33638 WP_000887629.1.33648 WP_000887629.1.33667 WP_000887629.1.33680 WP_000887629.1.33729 WP_000887629.1.33736 WP_000887629.1.33745 WP_000887629.1.33746 WP_000887629.1.33751 WP_000887629.1.33780 WP_000887629.1.33799 WP_000887629.1.33823 WP_000887629.1.33853 WP_000887629.1.33854 WP_000887629.1.33879 WP_000887629.1.33888 WP_000887629.1.33914 WP_000887629.1.33948 WP_000887629.1.33952 WP_000887629.1.33973 WP_000887629.1.33974 WP_000887629.1.33979 WP_000887629.1.3398 WP_000887629.1.33981 WP_000887629.1.34003 WP_000887629.1.3401 WP_000887629.1.34094 WP_000887629.1.3411 WP_000887629.1.34117 WP_000887629.1.34121 WP_000887629.1.34122 WP_000887629.1.34124 WP_000887629.1.34130 WP_000887629.1.3415 WP_000887629.1.34204 WP_000887629.1.34206 WP_000887629.1.34224 WP_000887629.1.34269 WP_000887629.1.34270 WP_000887629.1.34273 WP_000887629.1.34277 WP_000887629.1.34294 WP_000887629.1.34303 WP_000887629.1.3432 WP_000887629.1.34332 WP_000887629.1.34363 WP_000887629.1.34380 WP_000887629.1.34383 WP_000887629.1.3439 WP_000887629.1.34397 WP_000887629.1.34422 WP_000887629.1.3444 WP_000887629.1.34440 WP_000887629.1.34444 WP_000887629.1.34456 WP_000887629.1.34464 WP_000887629.1.34500 WP_000887629.1.34525 WP_000887629.1.34532 WP_000887629.1.34538 WP_000887629.1.34541 WP_000887629.1.34557 WP_000887629.1.3460 WP_000887629.1.34605 WP_000887629.1.34655 WP_000887629.1.34668 WP_000887629.1.34680 WP_000887629.1.34682 WP_000887629.1.34683 WP_000887629.1.34686 WP_000887629.1.347 WP_000887629.1.3472 WP_000887629.1.34727 WP_000887629.1.34763 WP_000887629.1.34781 WP_000887629.1.34782 WP_000887629.1.34794 WP_000887629.1.34827 WP_000887629.1.34835 WP_000887629.1.34855 WP_000887629.1.34875 WP_000887629.1.34887 WP_000887629.1.34913 WP_000887629.1.34931 WP_000887629.1.34966 WP_000887629.1.34982 WP_000887629.1.34983 WP_000887629.1.34990 WP_000887629.1.34993 WP_000887629.1.35006 WP_000887629.1.35007 WP_000887629.1.35039 WP_000887629.1.35114 WP_000887629.1.35127 WP_000887629.1.3515 WP_000887629.1.35180 WP_000887629.1.35186 WP_000887629.1.35195 WP_000887629.1.35198 WP_000887629.1.35202 WP_000887629.1.35204 WP_000887629.1.3521 WP_000887629.1.35211 WP_000887629.1.35316 WP_000887629.1.35360 WP_000887629.1.3539 WP_000887629.1.35393 WP_000887629.1.35398 WP_000887629.1.35464 WP_000887629.1.35465 WP_000887629.1.35466 WP_000887629.1.35468 WP_000887629.1.35483 WP_000887629.1.3550 WP_000887629.1.35552 WP_000887629.1.35581 WP_000887629.1.3560 WP_000887629.1.35604 WP_000887629.1.35627 WP_000887629.1.35651 WP_000887629.1.35653 WP_000887629.1.35654 WP_000887629.1.35724 WP_000887629.1.35740 WP_000887629.1.35789 WP_000887629.1.35904 WP_000887629.1.35922 WP_000887629.1.35927 WP_000887629.1.35934 WP_000887629.1.35959 WP_000887629.1.35963 WP_000887629.1.3598 WP_000887629.1.35983 WP_000887629.1.35987 WP_000887629.1.35990 WP_000887629.1.3600 WP_000887629.1.36010 WP_000887629.1.36040 WP_000887629.1.36042 WP_000887629.1.36070 WP_000887629.1.36071 WP_000887629.1.36085 WP_000887629.1.36094 WP_000887629.1.36158 WP_000887629.1.36159 WP_000887629.1.36164 WP_000887629.1.36166 WP_000887629.1.36177 WP_000887629.1.36182 WP_000887629.1.36207 WP_000887629.1.36212 WP_000887629.1.3624 WP_000887629.1.36281 WP_000887629.1.36299 WP_000887629.1.36334 WP_000887629.1.36386 WP_000887629.1.36405 WP_000887629.1.36412 WP_000887629.1.36414 WP_000887629.1.36426 WP_000887629.1.3643 WP_000887629.1.36496 WP_000887629.1.365 WP_000887629.1.36500 WP_000887629.1.36507 WP_000887629.1.36523 WP_000887629.1.36531 WP_000887629.1.36537 WP_000887629.1.36545 WP_000887629.1.36610 WP_000887629.1.36626 WP_000887629.1.36627 WP_000887629.1.36628 WP_000887629.1.36699 WP_000887629.1.36707 WP_000887629.1.3671 WP_000887629.1.36724 WP_000887629.1.36739 WP_000887629.1.36746 WP_000887629.1.36747 WP_000887629.1.36761 WP_000887629.1.36767 WP_000887629.1.36799 WP_000887629.1.36806 WP_000887629.1.36812 WP_000887629.1.36817 WP_000887629.1.36826 WP_000887629.1.36833 WP_000887629.1.36856 WP_000887629.1.36904 WP_000887629.1.3697 WP_000887629.1.36971 WP_000887629.1.36975 WP_000887629.1.37006 WP_000887629.1.37020 WP_000887629.1.37046 WP_000887629.1.37057 WP_000887629.1.37076 WP_000887629.1.37099 WP_000887629.1.37101 WP_000887629.1.37102 WP_000887629.1.37103 WP_000887629.1.37122 WP_000887629.1.37146 WP_000887629.1.37206 WP_000887629.1.37226 WP_000887629.1.3723 WP_000887629.1.37233 WP_000887629.1.37252 WP_000887629.1.37261 WP_000887629.1.37266 WP_000887629.1.3730 WP_000887629.1.37306 WP_000887629.1.37312 WP_000887629.1.37313 WP_000887629.1.37329 WP_000887629.1.37334 WP_000887629.1.37337 WP_000887629.1.37342 WP_000887629.1.37352 WP_000887629.1.37371 WP_000887629.1.37372 WP_000887629.1.37419 WP_000887629.1.37423 WP_000887629.1.37433 WP_000887629.1.37472 WP_000887629.1.37476 WP_000887629.1.37485 WP_000887629.1.3749 WP_000887629.1.37510 WP_000887629.1.37538 WP_000887629.1.37543 WP_000887629.1.37544 WP_000887629.1.37548 WP_000887629.1.37550 WP_000887629.1.37554 WP_000887629.1.37576 WP_000887629.1.37588 WP_000887629.1.37592 WP_000887629.1.37608 WP_000887629.1.3762 WP_000887629.1.37634 WP_000887629.1.37664 WP_000887629.1.377 WP_000887629.1.3772 WP_000887629.1.37731 WP_000887629.1.37736 WP_000887629.1.37745 WP_000887629.1.37750 WP_000887629.1.37758 WP_000887629.1.37762 WP_000887629.1.37766 WP_000887629.1.37769 WP_000887629.1.37773 WP_000887629.1.37847 WP_000887629.1.37852 WP_000887629.1.37853 WP_000887629.1.3788 WP_000887629.1.37880 WP_000887629.1.37887 WP_000887629.1.37897 WP_000887629.1.37917 WP_000887629.1.37926 WP_000887629.1.37940 WP_000887629.1.3795 WP_000887629.1.37962 WP_000887629.1.37967 WP_000887629.1.37995 WP_000887629.1.37998 WP_000887629.1.38000 WP_000887629.1.38033 WP_000887629.1.38050 WP_000887629.1.38063 WP_000887629.1.38080 WP_000887629.1.38081 WP_000887629.1.38085 WP_000887629.1.38103 WP_000887629.1.38105 WP_000887629.1.38107 WP_000887629.1.3811 WP_000887629.1.38120 WP_000887629.1.3815 WP_000887629.1.38155 WP_000887629.1.38162 WP_000887629.1.38182 WP_000887629.1.38185 WP_000887629.1.38194 WP_000887629.1.38211 WP_000887629.1.3822 WP_000887629.1.38257 WP_000887629.1.38264 WP_000887629.1.38293 WP_000887629.1.38300 WP_000887629.1.38306 WP_000887629.1.38314 WP_000887629.1.38323 WP_000887629.1.38357 WP_000887629.1.38363 WP_000887629.1.38369 WP_000887629.1.38371 WP_000887629.1.38392 WP_000887629.1.38412 WP_000887629.1.38419 WP_000887629.1.38485 WP_000887629.1.38533 WP_000887629.1.38544 WP_000887629.1.38561 WP_000887629.1.38567 WP_000887629.1.38584 WP_000887629.1.38610 WP_000887629.1.38626 WP_000887629.1.38629 WP_000887629.1.38636 WP_000887629.1.38694 WP_000887629.1.38722 WP_000887629.1.3873 WP_000887629.1.38751 WP_000887629.1.38777 WP_000887629.1.38782 WP_000887629.1.38811 WP_000887629.1.38827 WP_000887629.1.38843 WP_000887629.1.38896 WP_000887629.1.389 WP_000887629.1.38911 WP_000887629.1.38920 WP_000887629.1.38935 WP_000887629.1.38937 WP_000887629.1.38950 WP_000887629.1.38958 WP_000887629.1.39005 WP_000887629.1.39015 WP_000887629.1.3903 WP_000887629.1.39037 WP_000887629.1.3904 WP_000887629.1.39042 WP_000887629.1.39103 WP_000887629.1.39123 WP_000887629.1.39150 WP_000887629.1.39155 WP_000887629.1.39157 WP_000887629.1.39164 WP_000887629.1.39167 WP_000887629.1.39171 WP_000887629.1.39180 WP_000887629.1.3921 WP_000887629.1.39232 WP_000887629.1.39249 WP_000887629.1.39268 WP_000887629.1.39289 WP_000887629.1.39302 WP_000887629.1.39305 WP_000887629.1.39310 WP_000887629.1.39327 WP_000887629.1.39335 WP_000887629.1.39342 WP_000887629.1.39356 WP_000887629.1.39365 WP_000887629.1.39367 WP_000887629.1.39373 WP_000887629.1.39377 WP_000887629.1.39401 WP_000887629.1.39415 WP_000887629.1.39430 WP_000887629.1.39468 WP_000887629.1.39481 WP_000887629.1.39509 WP_000887629.1.39531 WP_000887629.1.3954 WP_000887629.1.39541 WP_000887629.1.39564 WP_000887629.1.39575 WP_000887629.1.39580 WP_000887629.1.39601 WP_000887629.1.39606 WP_000887629.1.39607 WP_000887629.1.39610 WP_000887629.1.39690 WP_000887629.1.3970 WP_000887629.1.39708 WP_000887629.1.39713 WP_000887629.1.39715 WP_000887629.1.39726 WP_000887629.1.39730 WP_000887629.1.39758 WP_000887629.1.39780 WP_000887629.1.39796 WP_000887629.1.3980 WP_000887629.1.39809 WP_000887629.1.39818 WP_000887629.1.39820 WP_000887629.1.39822 WP_000887629.1.39829 WP_000887629.1.39867 WP_000887629.1.39870 WP_000887629.1.39892 WP_000887629.1.39938 WP_000887629.1.39961 WP_000887629.1.39970 WP_000887629.1.39998 WP_000887629.1.40013 WP_000887629.1.40016 WP_000887629.1.40083 WP_000887629.1.40107 WP_000887629.1.40113 WP_000887629.1.40121 WP_000887629.1.40140 WP_000887629.1.40153 WP_000887629.1.40159 WP_000887629.1.40183 WP_000887629.1.40190 WP_000887629.1.40192 WP_000887629.1.4020 WP_000887629.1.40206 WP_000887629.1.40211 WP_000887629.1.40212 WP_000887629.1.40218 WP_000887629.1.40234 WP_000887629.1.40238 WP_000887629.1.40249 WP_000887629.1.40298 WP_000887629.1.4030 WP_000887629.1.40300 WP_000887629.1.40315 WP_000887629.1.40317 WP_000887629.1.40319 WP_000887629.1.40335 WP_000887629.1.40345 WP_000887629.1.40360 WP_000887629.1.40382 WP_000887629.1.40389 WP_000887629.1.40391 WP_000887629.1.40403 WP_000887629.1.40445 WP_000887629.1.4049 WP_000887629.1.40499 WP_000887629.1.40502 WP_000887629.1.40509 WP_000887629.1.40524 WP_000887629.1.40539 WP_000887629.1.40548 WP_000887629.1.40560 WP_000887629.1.40563 WP_000887629.1.40596 WP_000887629.1.40599 WP_000887629.1.406 WP_000887629.1.40617 WP_000887629.1.40623 WP_000887629.1.40636 WP_000887629.1.40657 WP_000887629.1.40660 WP_000887629.1.40668 WP_000887629.1.40686 WP_000887629.1.40712 WP_000887629.1.40715 WP_000887629.1.40742 WP_000887629.1.40758 WP_000887629.1.40781 WP_000887629.1.40793 WP_000887629.1.4081 WP_000887629.1.40813 WP_000887629.1.40815 WP_000887629.1.4082 WP_000887629.1.40833 WP_000887629.1.40842 WP_000887629.1.40865 WP_000887629.1.40882 WP_000887629.1.40898 WP_000887629.1.40912 WP_000887629.1.40937 WP_000887629.1.40952 WP_000887629.1.40965 WP_000887629.1.4103 WP_000887629.1.41037 WP_000887629.1.41045 WP_000887629.1.41060 WP_000887629.1.41113 WP_000887629.1.41125 WP_000887629.1.41147 WP_000887629.1.41206 WP_000887629.1.41230 WP_000887629.1.41239 WP_000887629.1.41244 WP_000887629.1.41259 WP_000887629.1.4126 WP_000887629.1.41263 WP_000887629.1.41271 WP_000887629.1.41287 WP_000887629.1.41294 WP_000887629.1.41315 WP_000887629.1.41330 WP_000887629.1.41346 WP_000887629.1.41363 WP_000887629.1.41368 WP_000887629.1.41371 WP_000887629.1.41392 WP_000887629.1.41394 WP_000887629.1.41401 WP_000887629.1.41402 WP_000887629.1.41407 WP_000887629.1.41417 WP_000887629.1.4142 WP_000887629.1.41436 WP_000887629.1.41453 WP_000887629.1.41455 WP_000887629.1.41457 WP_000887629.1.41466 WP_000887629.1.41478 WP_000887629.1.41481 WP_000887629.1.41482 WP_000887629.1.41484 WP_000887629.1.41488 WP_000887629.1.41530 WP_000887629.1.41536 WP_000887629.1.41539 WP_000887629.1.41545 WP_000887629.1.41556 WP_000887629.1.4158 WP_000887629.1.41606 WP_000887629.1.41613 WP_000887629.1.41621 WP_000887629.1.41651 WP_000887629.1.41654 WP_000887629.1.41712 WP_000887629.1.41718 WP_000887629.1.4172 WP_000887629.1.41734 WP_000887629.1.41740 WP_000887629.1.41741 WP_000887629.1.41752 WP_000887629.1.41778 WP_000887629.1.41780 WP_000887629.1.41782 WP_000887629.1.41783 WP_000887629.1.41812 WP_000887629.1.41813 WP_000887629.1.41822 WP_000887629.1.41826 WP_000887629.1.41847 WP_000887629.1.41884 WP_000887629.1.41885 WP_000887629.1.4189 WP_000887629.1.41900 WP_000887629.1.41923 WP_000887629.1.41960 WP_000887629.1.41964 WP_000887629.1.41990 WP_000887629.1.41991 WP_000887629.1.42022 WP_000887629.1.42027 WP_000887629.1.42033 WP_000887629.1.42036 WP_000887629.1.42038 WP_000887629.1.42060 WP_000887629.1.42073 WP_000887629.1.42095 WP_000887629.1.42096 WP_000887629.1.42113 WP_000887629.1.4213 WP_000887629.1.42138 WP_000887629.1.4214 WP_000887629.1.42159 WP_000887629.1.42179 WP_000887629.1.42191 WP_000887629.1.42203 WP_000887629.1.42209 WP_000887629.1.42214 WP_000887629.1.42226 WP_000887629.1.42228 WP_000887629.1.42233 WP_000887629.1.4224 WP_000887629.1.42252 WP_000887629.1.42277 WP_000887629.1.42284 WP_000887629.1.42300 WP_000887629.1.42350 WP_000887629.1.42359 WP_000887629.1.42367 WP_000887629.1.42369 WP_000887629.1.42376 WP_000887629.1.42387 WP_000887629.1.42413 WP_000887629.1.42415 WP_000887629.1.4242 WP_000887629.1.42432 WP_000887629.1.42442 WP_000887629.1.42447 WP_000887629.1.42456 WP_000887629.1.42480 WP_000887629.1.4250 WP_000887629.1.42513 WP_000887629.1.42516 WP_000887629.1.42522 WP_000887629.1.42547 WP_000887629.1.42586 WP_000887629.1.42594 WP_000887629.1.42601 WP_000887629.1.4261 WP_000887629.1.42632 WP_000887629.1.42638 WP_000887629.1.42661 WP_000887629.1.42669 WP_000887629.1.42670 WP_000887629.1.42677 WP_000887629.1.42728 WP_000887629.1.42749 WP_000887629.1.42750 WP_000887629.1.42756 WP_000887629.1.42770 WP_000887629.1.42771 WP_000887629.1.42791 WP_000887629.1.42804 WP_000887629.1.42813 WP_000887629.1.4282 WP_000887629.1.42828 WP_000887629.1.42830 WP_000887629.1.42832 WP_000887629.1.42879 WP_000887629.1.42891 WP_000887629.1.42903 WP_000887629.1.42918 WP_000887629.1.42936 WP_000887629.1.42937 WP_000887629.1.42950 WP_000887629.1.42962 WP_000887629.1.42966 WP_000887629.1.42970 WP_000887629.1.42975 WP_000887629.1.42987 WP_000887629.1.42989 WP_000887629.1.42991 WP_000887629.1.43013 WP_000887629.1.43027 WP_000887629.1.43035 WP_000887629.1.4306 WP_000887629.1.43121 WP_000887629.1.4313 WP_000887629.1.43132 WP_000887629.1.43137 WP_000887629.1.43140 WP_000887629.1.43166 WP_000887629.1.43170 WP_000887629.1.43174 WP_000887629.1.43177 WP_000887629.1.43196 WP_000887629.1.43239 WP_000887629.1.43270 WP_000887629.1.43278 WP_000887629.1.43316 WP_000887629.1.43324 WP_000887629.1.4334 WP_000887629.1.43363 WP_000887629.1.43374 WP_000887629.1.43384 WP_000887629.1.4342 WP_000887629.1.43422 WP_000887629.1.4343 WP_000887629.1.43444 WP_000887629.1.43448 WP_000887629.1.43455 WP_000887629.1.43469 WP_000887629.1.43473 WP_000887629.1.43474 WP_000887629.1.43489 WP_000887629.1.43536 WP_000887629.1.4356 WP_000887629.1.43566 WP_000887629.1.43604 WP_000887629.1.43622 WP_000887629.1.43642 WP_000887629.1.43720 WP_000887629.1.43733 WP_000887629.1.43750 WP_000887629.1.43754 WP_000887629.1.43769 WP_000887629.1.43798 WP_000887629.1.43803 WP_000887629.1.43804 WP_000887629.1.43816 WP_000887629.1.43837 WP_000887629.1.43858 WP_000887629.1.43898 WP_000887629.1.43911 WP_000887629.1.43918 WP_000887629.1.43925 WP_000887629.1.43939 WP_000887629.1.43942 WP_000887629.1.43953 WP_000887629.1.43989 WP_000887629.1.440 WP_000887629.1.4400 WP_000887629.1.44018 WP_000887629.1.44020 WP_000887629.1.44029 WP_000887629.1.44040 WP_000887629.1.44075 WP_000887629.1.44077 WP_000887629.1.44088 WP_000887629.1.44096 WP_000887629.1.44100 WP_000887629.1.4411 WP_000887629.1.44115 WP_000887629.1.44125 WP_000887629.1.44130 WP_000887629.1.4415 WP_000887629.1.44162 WP_000887629.1.44165 WP_000887629.1.44166 WP_000887629.1.44203 WP_000887629.1.44211 WP_000887629.1.44238 WP_000887629.1.44251 WP_000887629.1.44263 WP_000887629.1.44264 WP_000887629.1.44287 WP_000887629.1.44292 WP_000887629.1.44314 WP_000887629.1.44324 WP_000887629.1.44354 WP_000887629.1.44365 WP_000887629.1.44389 WP_000887629.1.44424 WP_000887629.1.44426 WP_000887629.1.44445 WP_000887629.1.44447 WP_000887629.1.44452 WP_000887629.1.44460 WP_000887629.1.44461 WP_000887629.1.44488 WP_000887629.1.4449 WP_000887629.1.44524 WP_000887629.1.44539 WP_000887629.1.44561 WP_000887629.1.44587 WP_000887629.1.44608 WP_000887629.1.44622 WP_000887629.1.44649 WP_000887629.1.44661 WP_000887629.1.44686 WP_000887629.1.44724 WP_000887629.1.4473 WP_000887629.1.44733 WP_000887629.1.44756 WP_000887629.1.44759 WP_000887629.1.44784 WP_000887629.1.448 WP_000887629.1.44800 WP_000887629.1.44814 WP_000887629.1.44818 WP_000887629.1.44821 WP_000887629.1.44840 WP_000887629.1.44841 WP_000887629.1.44843 WP_000887629.1.44848 WP_000887629.1.44849 WP_000887629.1.44854 WP_000887629.1.44857 WP_000887629.1.44906 WP_000887629.1.44923 WP_000887629.1.44954 WP_000887629.1.44960 WP_000887629.1.44961 WP_000887629.1.44970 WP_000887629.1.44980 WP_000887629.1.45020 WP_000887629.1.45025 WP_000887629.1.45028 WP_000887629.1.45043 WP_000887629.1.45053 WP_000887629.1.45068 WP_000887629.1.45076 WP_000887629.1.45116 WP_000887629.1.45153 WP_000887629.1.45156 WP_000887629.1.4516 WP_000887629.1.45195 WP_000887629.1.45208 WP_000887629.1.4524 WP_000887629.1.45246 WP_000887629.1.45293 WP_000887629.1.45301 WP_000887629.1.45313 WP_000887629.1.45329 WP_000887629.1.45359 WP_000887629.1.45404 WP_000887629.1.45405 WP_000887629.1.4541 WP_000887629.1.45444 WP_000887629.1.45486 WP_000887629.1.4549 WP_000887629.1.45494 WP_000887629.1.45500 WP_000887629.1.45536 WP_000887629.1.45538 WP_000887629.1.45565 WP_000887629.1.45581 WP_000887629.1.45600 WP_000887629.1.45627 WP_000887629.1.4563 WP_000887629.1.45664 WP_000887629.1.45674 WP_000887629.1.45676 WP_000887629.1.4570 WP_000887629.1.45707 WP_000887629.1.45718 WP_000887629.1.4574 WP_000887629.1.45741 WP_000887629.1.45752 WP_000887629.1.4576 WP_000887629.1.45793 WP_000887629.1.4583 WP_000887629.1.45840 WP_000887629.1.45841 WP_000887629.1.45846 WP_000887629.1.45865 WP_000887629.1.45868 WP_000887629.1.45901 WP_000887629.1.45921 WP_000887629.1.4593 WP_000887629.1.45933 WP_000887629.1.45941 WP_000887629.1.45960 WP_000887629.1.45962 WP_000887629.1.45968 WP_000887629.1.45990 WP_000887629.1.45991 WP_000887629.1.4600 WP_000887629.1.46016 WP_000887629.1.46026 WP_000887629.1.46027 WP_000887629.1.46039 WP_000887629.1.46048 WP_000887629.1.46049 WP_000887629.1.46070 WP_000887629.1.46081 WP_000887629.1.4610 WP_000887629.1.46105 WP_000887629.1.46115 WP_000887629.1.46122 WP_000887629.1.4613 WP_000887629.1.46164 WP_000887629.1.4617 WP_000887629.1.46186 WP_000887629.1.4619 WP_000887629.1.46197 WP_000887629.1.46213 WP_000887629.1.46239 WP_000887629.1.46245 WP_000887629.1.46257 WP_000887629.1.46263 WP_000887629.1.46282 WP_000887629.1.46283 WP_000887629.1.46291 WP_000887629.1.46301 WP_000887629.1.46325 WP_000887629.1.46329 WP_000887629.1.46369 WP_000887629.1.46379 WP_000887629.1.46414 WP_000887629.1.4643 WP_000887629.1.46441 WP_000887629.1.46451 WP_000887629.1.4646 WP_000887629.1.46468 WP_000887629.1.4647 WP_000887629.1.46477 WP_000887629.1.46503 WP_000887629.1.46526 WP_000887629.1.46541 WP_000887629.1.46552 WP_000887629.1.46555 WP_000887629.1.4657 WP_000887629.1.46573 WP_000887629.1.46582 WP_000887629.1.46589 WP_000887629.1.46594 WP_000887629.1.46597 WP_000887629.1.46602 WP_000887629.1.46611 WP_000887629.1.46614 WP_000887629.1.46616 WP_000887629.1.46626 WP_000887629.1.46643 WP_000887629.1.46655 WP_000887629.1.46668 WP_000887629.1.4670 WP_000887629.1.46734 WP_000887629.1.46743 WP_000887629.1.46798 WP_000887629.1.46802 WP_000887629.1.46806 WP_000887629.1.46810 WP_000887629.1.46820 WP_000887629.1.46821 WP_000887629.1.46832 WP_000887629.1.46833 WP_000887629.1.46857 WP_000887629.1.46860 WP_000887629.1.46876 WP_000887629.1.46882 WP_000887629.1.46898 WP_000887629.1.46909 WP_000887629.1.4691 WP_000887629.1.46912 WP_000887629.1.46913 WP_000887629.1.46932 WP_000887629.1.4695 WP_000887629.1.46990 WP_000887629.1.46991 WP_000887629.1.46994 WP_000887629.1.46999 WP_000887629.1.47028 WP_000887629.1.47029 WP_000887629.1.47030 WP_000887629.1.47034 WP_000887629.1.47038 WP_000887629.1.47039 WP_000887629.1.47048 WP_000887629.1.47050 WP_000887629.1.47054 WP_000887629.1.47069 WP_000887629.1.4708 WP_000887629.1.47135 WP_000887629.1.47140 WP_000887629.1.47156 WP_000887629.1.47167 WP_000887629.1.47171 WP_000887629.1.47186 WP_000887629.1.47197 WP_000887629.1.47198 WP_000887629.1.4722 WP_000887629.1.47224 WP_000887629.1.4723 WP_000887629.1.47246 WP_000887629.1.4725 WP_000887629.1.47280 WP_000887629.1.47307 WP_000887629.1.47316 WP_000887629.1.47319 WP_000887629.1.47322 WP_000887629.1.47332 WP_000887629.1.47344 WP_000887629.1.47349 WP_000887629.1.47350 WP_000887629.1.47356 WP_000887629.1.47363 WP_000887629.1.47370 WP_000887629.1.47386 WP_000887629.1.47398 WP_000887629.1.4740 WP_000887629.1.47401 WP_000887629.1.47411 WP_000887629.1.47414 WP_000887629.1.47416 WP_000887629.1.47425 WP_000887629.1.4743 WP_000887629.1.47451 WP_000887629.1.47464 WP_000887629.1.47473 WP_000887629.1.47477 WP_000887629.1.47488 WP_000887629.1.47496 WP_000887629.1.47498 WP_000887629.1.47555 WP_000887629.1.47582 WP_000887629.1.47634 WP_000887629.1.47646 WP_000887629.1.47654 WP_000887629.1.47662 WP_000887629.1.47673 WP_000887629.1.4772 WP_000887629.1.47722 WP_000887629.1.4773 WP_000887629.1.47734 WP_000887629.1.47740 WP_000887629.1.47744 WP_000887629.1.47761 WP_000887629.1.47764 WP_000887629.1.47765 WP_000887629.1.47784 WP_000887629.1.47790 WP_000887629.1.47791 WP_000887629.1.47820 WP_000887629.1.47827 WP_000887629.1.4783 WP_000887629.1.47848 WP_000887629.1.4785 WP_000887629.1.47884 WP_000887629.1.47914 WP_000887629.1.47935 WP_000887629.1.47954 WP_000887629.1.4796 WP_000887629.1.47976 WP_000887629.1.47981 WP_000887629.1.47983 WP_000887629.1.47994 WP_000887629.1.48000 WP_000887629.1.48018 WP_000887629.1.48040 WP_000887629.1.48048 WP_000887629.1.48051 WP_000887629.1.48065 WP_000887629.1.48073 WP_000887629.1.48077 WP_000887629.1.48080 WP_000887629.1.48087 WP_000887629.1.48090 WP_000887629.1.48111 WP_000887629.1.4812 WP_000887629.1.48144 WP_000887629.1.48176 WP_000887629.1.48188 WP_000887629.1.48194 WP_000887629.1.48200 WP_000887629.1.48203 WP_000887629.1.48222 WP_000887629.1.48226 WP_000887629.1.48229 WP_000887629.1.48258 WP_000887629.1.4826 WP_000887629.1.48265 WP_000887629.1.48285 WP_000887629.1.48290 WP_000887629.1.48291 WP_000887629.1.48317 WP_000887629.1.48353 WP_000887629.1.48355 WP_000887629.1.48371 WP_000887629.1.48385 WP_000887629.1.48404 WP_000887629.1.48417 WP_000887629.1.48421 WP_000887629.1.48433 WP_000887629.1.48469 WP_000887629.1.48477 WP_000887629.1.48483 WP_000887629.1.48505 WP_000887629.1.48522 WP_000887629.1.4857 WP_000887629.1.48571 WP_000887629.1.48590 WP_000887629.1.486 WP_000887629.1.48602 WP_000887629.1.48615 WP_000887629.1.48620 WP_000887629.1.48626 WP_000887629.1.48629 WP_000887629.1.48678 WP_000887629.1.48697 WP_000887629.1.4871 WP_000887629.1.48712 WP_000887629.1.48771 WP_000887629.1.48792 WP_000887629.1.48801 WP_000887629.1.48806 WP_000887629.1.48808 WP_000887629.1.48825 WP_000887629.1.48827 WP_000887629.1.48847 WP_000887629.1.48860 WP_000887629.1.48901 WP_000887629.1.48902 WP_000887629.1.48907 WP_000887629.1.48910 WP_000887629.1.4892 WP_000887629.1.48921 WP_000887629.1.48928 WP_000887629.1.48953 WP_000887629.1.48954 WP_000887629.1.48970 WP_000887629.1.48974 WP_000887629.1.49009 WP_000887629.1.49061 WP_000887629.1.49076 WP_000887629.1.49104 WP_000887629.1.49107 WP_000887629.1.49124 WP_000887629.1.49136 WP_000887629.1.49147 WP_000887629.1.49190 WP_000887629.1.49229 WP_000887629.1.49236 WP_000887629.1.49243 WP_000887629.1.49259 WP_000887629.1.49275 WP_000887629.1.4931 WP_000887629.1.49312 WP_000887629.1.49332 WP_000887629.1.49336 WP_000887629.1.49342 WP_000887629.1.49347 WP_000887629.1.49363 WP_000887629.1.49412 WP_000887629.1.49431 WP_000887629.1.49446 WP_000887629.1.49459 WP_000887629.1.49464 WP_000887629.1.49481 WP_000887629.1.49482 WP_000887629.1.4949 WP_000887629.1.49496 WP_000887629.1.49521 WP_000887629.1.49522 WP_000887629.1.49528 WP_000887629.1.49531 WP_000887629.1.49537 WP_000887629.1.49546 WP_000887629.1.49558 WP_000887629.1.49567 WP_000887629.1.49594 WP_000887629.1.49599 WP_000887629.1.49615 WP_000887629.1.49625 WP_000887629.1.49645 WP_000887629.1.49655 WP_000887629.1.49661 WP_000887629.1.49662 WP_000887629.1.49675 WP_000887629.1.49684 WP_000887629.1.497 WP_000887629.1.49712 WP_000887629.1.49722 WP_000887629.1.49733 WP_000887629.1.49740 WP_000887629.1.49747 WP_000887629.1.49768 WP_000887629.1.49771 WP_000887629.1.49774 WP_000887629.1.49777 WP_000887629.1.49783 WP_000887629.1.49788 WP_000887629.1.49794 WP_000887629.1.49820 WP_000887629.1.4985 WP_000887629.1.49856 WP_000887629.1.49861 WP_000887629.1.49879 WP_000887629.1.49883 WP_000887629.1.49884 WP_000887629.1.49900 WP_000887629.1.49902 WP_000887629.1.49941 WP_000887629.1.49950 WP_000887629.1.49954 WP_000887629.1.49972 WP_000887629.1.49987 WP_000887629.1.50006 WP_000887629.1.50008 WP_000887629.1.5003 WP_000887629.1.50036 WP_000887629.1.50058 WP_000887629.1.50078 WP_000887629.1.50098 WP_000887629.1.50113 WP_000887629.1.50119 WP_000887629.1.50136 WP_000887629.1.5017 WP_000887629.1.50179 WP_000887629.1.50182 WP_000887629.1.50191 WP_000887629.1.50196 WP_000887629.1.50207 WP_000887629.1.50230 WP_000887629.1.50258 WP_000887629.1.50262 WP_000887629.1.50266 WP_000887629.1.50269 WP_000887629.1.50270 WP_000887629.1.50273 WP_000887629.1.50278 WP_000887629.1.50329 WP_000887629.1.50345 WP_000887629.1.50353 WP_000887629.1.50358 WP_000887629.1.50361 WP_000887629.1.50366 WP_000887629.1.5037 WP_000887629.1.50380 WP_000887629.1.50381 WP_000887629.1.5040 WP_000887629.1.5041 WP_000887629.1.50418 WP_000887629.1.50452 WP_000887629.1.5046 WP_000887629.1.50539 WP_000887629.1.50548 WP_000887629.1.50549 WP_000887629.1.5056 WP_000887629.1.50564 WP_000887629.1.50579 WP_000887629.1.50585 WP_000887629.1.50586 WP_000887629.1.506 WP_000887629.1.50608 WP_000887629.1.5061 WP_000887629.1.50616 WP_000887629.1.5064 WP_000887629.1.5067 WP_000887629.1.50690 WP_000887629.1.50700 WP_000887629.1.50715 WP_000887629.1.50717 WP_000887629.1.50725 WP_000887629.1.50762 WP_000887629.1.50887 WP_000887629.1.50936 WP_000887629.1.50939 WP_000887629.1.50947 WP_000887629.1.5095 WP_000887629.1.50957 WP_000887629.1.50969 WP_000887629.1.50986 WP_000887629.1.50988 WP_000887629.1.50990 WP_000887629.1.50993 WP_000887629.1.50996 WP_000887629.1.51013 WP_000887629.1.51027 WP_000887629.1.51042 WP_000887629.1.51058 WP_000887629.1.5106 WP_000887629.1.51109 WP_000887629.1.51127 WP_000887629.1.51154 WP_000887629.1.51170 WP_000887629.1.51171 WP_000887629.1.51172 WP_000887629.1.51175 WP_000887629.1.51180 WP_000887629.1.51190 WP_000887629.1.51201 WP_000887629.1.51203 WP_000887629.1.51211 WP_000887629.1.5124 WP_000887629.1.51248 WP_000887629.1.51253 WP_000887629.1.51255 WP_000887629.1.51260 WP_000887629.1.51278 WP_000887629.1.51299 WP_000887629.1.51300 WP_000887629.1.51307 WP_000887629.1.51320 WP_000887629.1.51323 WP_000887629.1.51325 WP_000887629.1.51330 WP_000887629.1.51336 WP_000887629.1.51354 WP_000887629.1.51380 WP_000887629.1.51392 WP_000887629.1.51405 WP_000887629.1.51425 WP_000887629.1.51427 WP_000887629.1.51441 WP_000887629.1.5146 WP_000887629.1.51462 WP_000887629.1.51482 WP_000887629.1.51490 WP_000887629.1.51495 WP_000887629.1.51503 WP_000887629.1.51505 WP_000887629.1.51513 WP_000887629.1.51525 WP_000887629.1.51537 WP_000887629.1.51539 WP_000887629.1.51542 WP_000887629.1.51548 WP_000887629.1.51552 WP_000887629.1.5157 WP_000887629.1.51580 WP_000887629.1.51587 WP_000887629.1.51596 WP_000887629.1.51607 WP_000887629.1.51624 WP_000887629.1.51629 WP_000887629.1.51643 WP_000887629.1.51662 WP_000887629.1.51690 WP_000887629.1.51693 WP_000887629.1.51707 WP_000887629.1.51718 WP_000887629.1.5172 WP_000887629.1.51757 WP_000887629.1.51784 WP_000887629.1.518 WP_000887629.1.51834 WP_000887629.1.51837 WP_000887629.1.51839 WP_000887629.1.51869 WP_000887629.1.51881 WP_000887629.1.51896 WP_000887629.1.51899 WP_000887629.1.51906 WP_000887629.1.51944 WP_000887629.1.51968 WP_000887629.1.51985 WP_000887629.1.51988 WP_000887629.1.5199 WP_000887629.1.51999 WP_000887629.1.52002 WP_000887629.1.52011 WP_000887629.1.52020 WP_000887629.1.52039 WP_000887629.1.52044 WP_000887629.1.52048 WP_000887629.1.52062 WP_000887629.1.52076 WP_000887629.1.52098 WP_000887629.1.52111 WP_000887629.1.52126 WP_000887629.1.52127 WP_000887629.1.52135 WP_000887629.1.5217 WP_000887629.1.52171 WP_000887629.1.52186 WP_000887629.1.52200 WP_000887629.1.52211 WP_000887629.1.52214 WP_000887629.1.52225 WP_000887629.1.52230 WP_000887629.1.52236 WP_000887629.1.52240 WP_000887629.1.52243 WP_000887629.1.52249 WP_000887629.1.5227 WP_000887629.1.52270 WP_000887629.1.52271 WP_000887629.1.52272 WP_000887629.1.52304 WP_000887629.1.52305 WP_000887629.1.52313 WP_000887629.1.52324 WP_000887629.1.52328 WP_000887629.1.52333 WP_000887629.1.52363 WP_000887629.1.52378 WP_000887629.1.5239 WP_000887629.1.52399 WP_000887629.1.52413 WP_000887629.1.52419 WP_000887629.1.52421 WP_000887629.1.52492 WP_000887629.1.52496 WP_000887629.1.52524 WP_000887629.1.52542 WP_000887629.1.52543 WP_000887629.1.52544 WP_000887629.1.52554 WP_000887629.1.52558 WP_000887629.1.52567 WP_000887629.1.52601 WP_000887629.1.52612 WP_000887629.1.52631 WP_000887629.1.5265 WP_000887629.1.52662 WP_000887629.1.52691 WP_000887629.1.52710 WP_000887629.1.5272 WP_000887629.1.52735 WP_000887629.1.52755 WP_000887629.1.52762 WP_000887629.1.52774 WP_000887629.1.52777 WP_000887629.1.52780 WP_000887629.1.52801 WP_000887629.1.52844 WP_000887629.1.52846 WP_000887629.1.5285 WP_000887629.1.52853 WP_000887629.1.52881 WP_000887629.1.52883 WP_000887629.1.52895 WP_000887629.1.52913 WP_000887629.1.52933 WP_000887629.1.52942 WP_000887629.1.52945 WP_000887629.1.52962 WP_000887629.1.52995 WP_000887629.1.52996 WP_000887629.1.53012 WP_000887629.1.53020 WP_000887629.1.53027 WP_000887629.1.53065 WP_000887629.1.53084 WP_000887629.1.53099 WP_000887629.1.5310 WP_000887629.1.53110 WP_000887629.1.53123 WP_000887629.1.53155 WP_000887629.1.53181 WP_000887629.1.53186 WP_000887629.1.532 WP_000887629.1.53211 WP_000887629.1.5322 WP_000887629.1.53223 WP_000887629.1.53238 WP_000887629.1.53242 WP_000887629.1.53244 WP_000887629.1.53251 WP_000887629.1.53252 WP_000887629.1.53262 WP_000887629.1.53270 WP_000887629.1.53277 WP_000887629.1.53308 WP_000887629.1.53327 WP_000887629.1.53356 WP_000887629.1.53360 WP_000887629.1.53364 WP_000887629.1.53377 WP_000887629.1.53401 WP_000887629.1.53410 WP_000887629.1.53419 WP_000887629.1.5342 WP_000887629.1.53428 WP_000887629.1.53431 WP_000887629.1.53482 WP_000887629.1.53505 WP_000887629.1.5351 WP_000887629.1.53535 WP_000887629.1.53537 WP_000887629.1.53545 WP_000887629.1.53556 WP_000887629.1.53557 WP_000887629.1.53574 WP_000887629.1.53582 WP_000887629.1.53587 WP_000887629.1.53590 WP_000887629.1.53592 WP_000887629.1.53594 WP_000887629.1.5362 WP_000887629.1.53642 WP_000887629.1.53645 WP_000887629.1.53649 WP_000887629.1.53687 WP_000887629.1.53690 WP_000887629.1.53693 WP_000887629.1.53706 WP_000887629.1.53769 WP_000887629.1.53809 WP_000887629.1.53810 WP_000887629.1.53811 WP_000887629.1.53841 WP_000887629.1.53863 WP_000887629.1.53866 WP_000887629.1.53878 WP_000887629.1.53884 WP_000887629.1.5391 WP_000887629.1.5393 WP_000887629.1.53931 WP_000887629.1.5395 WP_000887629.1.53966 WP_000887629.1.53968 WP_000887629.1.53972 WP_000887629.1.53978 WP_000887629.1.53994 WP_000887629.1.54002 WP_000887629.1.54013 WP_000887629.1.54023 WP_000887629.1.54024 WP_000887629.1.54051 WP_000887629.1.54072 WP_000887629.1.54091 WP_000887629.1.54095 WP_000887629.1.54102 WP_000887629.1.54169 WP_000887629.1.54185 WP_000887629.1.54202 WP_000887629.1.54213 WP_000887629.1.54263 WP_000887629.1.54307 WP_000887629.1.54313 WP_000887629.1.54317 WP_000887629.1.54329 WP_000887629.1.5433 WP_000887629.1.54344 WP_000887629.1.54388 WP_000887629.1.54394 WP_000887629.1.5440 WP_000887629.1.5441 WP_000887629.1.54417 WP_000887629.1.54418 WP_000887629.1.54429 WP_000887629.1.54439 WP_000887629.1.54454 WP_000887629.1.54463 WP_000887629.1.54476 WP_000887629.1.54507 WP_000887629.1.54524 WP_000887629.1.54546 WP_000887629.1.54585 WP_000887629.1.54591 WP_000887629.1.5460 WP_000887629.1.54602 WP_000887629.1.54605 WP_000887629.1.54614 WP_000887629.1.54620 WP_000887629.1.54625 WP_000887629.1.54638 WP_000887629.1.54641 WP_000887629.1.5467 WP_000887629.1.54688 WP_000887629.1.54695 WP_000887629.1.5470 WP_000887629.1.54708 WP_000887629.1.54725 WP_000887629.1.54729 WP_000887629.1.54769 WP_000887629.1.5479 WP_000887629.1.54798 WP_000887629.1.54817 WP_000887629.1.54829 WP_000887629.1.5486 WP_000887629.1.54875 WP_000887629.1.54883 WP_000887629.1.54918 WP_000887629.1.54921 WP_000887629.1.54927 WP_000887629.1.54940 WP_000887629.1.54941 WP_000887629.1.54946 WP_000887629.1.54981 WP_000887629.1.54991 WP_000887629.1.54993 WP_000887629.1.55003 WP_000887629.1.55005 WP_000887629.1.55009 WP_000887629.1.55112 WP_000887629.1.55115 WP_000887629.1.55123 WP_000887629.1.55134 WP_000887629.1.55144 WP_000887629.1.55149 WP_000887629.1.55151 WP_000887629.1.55177 WP_000887629.1.55179 WP_000887629.1.55185 WP_000887629.1.55197 WP_000887629.1.5520 WP_000887629.1.55203 WP_000887629.1.55218 WP_000887629.1.55222 WP_000887629.1.55226 WP_000887629.1.55273 WP_000887629.1.55275 WP_000887629.1.55286 WP_000887629.1.55291 WP_000887629.1.55338 WP_000887629.1.55342 WP_000887629.1.55357 WP_000887629.1.55359 WP_000887629.1.55374 WP_000887629.1.55381 WP_000887629.1.55417 WP_000887629.1.55424 WP_000887629.1.55425 WP_000887629.1.55466 WP_000887629.1.55472 WP_000887629.1.55482 WP_000887629.1.55483 WP_000887629.1.55489 WP_000887629.1.55492 WP_000887629.1.55507 WP_000887629.1.55529 WP_000887629.1.55550 WP_000887629.1.55551 WP_000887629.1.55552 WP_000887629.1.55556 WP_000887629.1.55560 WP_000887629.1.55563 WP_000887629.1.55571 WP_000887629.1.55574 WP_000887629.1.55581 WP_000887629.1.55597 WP_000887629.1.55608 WP_000887629.1.5561 WP_000887629.1.55629 WP_000887629.1.5566 WP_000887629.1.55676 WP_000887629.1.5570 WP_000887629.1.55709 WP_000887629.1.55720 WP_000887629.1.55727 WP_000887629.1.55730 WP_000887629.1.55744 WP_000887629.1.55787 WP_000887629.1.55791 WP_000887629.1.55820 WP_000887629.1.55825 WP_000887629.1.55838 WP_000887629.1.55844 WP_000887629.1.55868 WP_000887629.1.55892 WP_000887629.1.55896 WP_000887629.1.55897 WP_000887629.1.55936 WP_000887629.1.55979 WP_000887629.1.55981 WP_000887629.1.55988 WP_000887629.1.55990 WP_000887629.1.56033 WP_000887629.1.56040 WP_000887629.1.56047 WP_000887629.1.56072 WP_000887629.1.561 WP_000887629.1.56101 WP_000887629.1.56139 WP_000887629.1.5614 WP_000887629.1.56142 WP_000887629.1.56149 WP_000887629.1.56151 WP_000887629.1.5616 WP_000887629.1.56164 WP_000887629.1.56169 WP_000887629.1.56177 WP_000887629.1.56193 WP_000887629.1.56216 WP_000887629.1.56231 WP_000887629.1.56278 WP_000887629.1.56285 WP_000887629.1.56302 WP_000887629.1.5632 WP_000887629.1.56338 WP_000887629.1.56345 WP_000887629.1.56388 WP_000887629.1.5639 WP_000887629.1.56390 WP_000887629.1.56392 WP_000887629.1.56399 WP_000887629.1.56402 WP_000887629.1.56436 WP_000887629.1.56439 WP_000887629.1.56446 WP_000887629.1.56457 WP_000887629.1.5646 WP_000887629.1.56469 WP_000887629.1.56481 WP_000887629.1.56489 WP_000887629.1.5649 WP_000887629.1.56491 WP_000887629.1.56501 WP_000887629.1.56513 WP_000887629.1.56523 WP_000887629.1.56528 WP_000887629.1.56543 WP_000887629.1.56554 WP_000887629.1.56571 WP_000887629.1.56573 WP_000887629.1.56650 WP_000887629.1.56662 WP_000887629.1.56680 WP_000887629.1.56689 WP_000887629.1.5670 WP_000887629.1.56704 WP_000887629.1.56713 WP_000887629.1.56714 WP_000887629.1.56721 WP_000887629.1.56742 WP_000887629.1.56776 WP_000887629.1.56777 WP_000887629.1.56786 WP_000887629.1.56799 WP_000887629.1.56821 WP_000887629.1.56830 WP_000887629.1.56835 WP_000887629.1.56846 WP_000887629.1.5685 WP_000887629.1.56908 WP_000887629.1.56932 WP_000887629.1.56933 WP_000887629.1.56934 WP_000887629.1.56936 WP_000887629.1.56937 WP_000887629.1.56951 WP_000887629.1.56978 WP_000887629.1.56980 WP_000887629.1.56992 WP_000887629.1.57011 WP_000887629.1.57032 WP_000887629.1.57045 WP_000887629.1.57068 WP_000887629.1.57071 WP_000887629.1.57072 WP_000887629.1.57079 WP_000887629.1.57086 WP_000887629.1.57100 WP_000887629.1.57124 WP_000887629.1.57180 WP_000887629.1.57181 WP_000887629.1.57185 WP_000887629.1.57197 WP_000887629.1.57202 WP_000887629.1.57213 WP_000887629.1.57216 WP_000887629.1.57269 WP_000887629.1.57280 WP_000887629.1.57281 WP_000887629.1.57319 WP_000887629.1.57386 WP_000887629.1.57401 WP_000887629.1.57403 WP_000887629.1.57410 WP_000887629.1.57414 WP_000887629.1.57432 WP_000887629.1.57451 WP_000887629.1.57453 WP_000887629.1.57466 WP_000887629.1.5748 WP_000887629.1.57487 WP_000887629.1.57492 WP_000887629.1.57517 WP_000887629.1.57538 WP_000887629.1.57539 WP_000887629.1.5755 WP_000887629.1.57550 WP_000887629.1.57558 WP_000887629.1.57574 WP_000887629.1.57588 WP_000887629.1.57610 WP_000887629.1.57628 WP_000887629.1.57629 WP_000887629.1.57634 WP_000887629.1.5764 WP_000887629.1.57646 WP_000887629.1.57659 WP_000887629.1.57663 WP_000887629.1.57669 WP_000887629.1.57738 WP_000887629.1.57812 WP_000887629.1.57836 WP_000887629.1.57846 WP_000887629.1.57851 WP_000887629.1.57854 WP_000887629.1.5786 WP_000887629.1.57898 WP_000887629.1.57903 WP_000887629.1.57904 WP_000887629.1.57920 WP_000887629.1.57951 WP_000887629.1.57975 WP_000887629.1.58001 WP_000887629.1.58009 WP_000887629.1.58022 WP_000887629.1.58038 WP_000887629.1.58045 WP_000887629.1.58048 WP_000887629.1.58057 WP_000887629.1.58060 WP_000887629.1.58080 WP_000887629.1.58094 WP_000887629.1.58107 WP_000887629.1.58128 WP_000887629.1.58143 WP_000887629.1.58146 WP_000887629.1.58163 WP_000887629.1.58169 WP_000887629.1.58172 WP_000887629.1.58206 WP_000887629.1.58226 WP_000887629.1.58232 WP_000887629.1.58238 WP_000887629.1.58248 WP_000887629.1.58267 WP_000887629.1.58289 WP_000887629.1.58316 WP_000887629.1.58340 WP_000887629.1.58368 WP_000887629.1.58371 WP_000887629.1.58384 WP_000887629.1.584 WP_000887629.1.58401 WP_000887629.1.58408 WP_000887629.1.58414 WP_000887629.1.5842 WP_000887629.1.58420 WP_000887629.1.58423 WP_000887629.1.58424 WP_000887629.1.58429 WP_000887629.1.58440 WP_000887629.1.58445 WP_000887629.1.58459 WP_000887629.1.58475 WP_000887629.1.58484 WP_000887629.1.58493 WP_000887629.1.58496 WP_000887629.1.58507 WP_000887629.1.58514 WP_000887629.1.5852 WP_000887629.1.58547 WP_000887629.1.58552 WP_000887629.1.58572 WP_000887629.1.58582 WP_000887629.1.58609 WP_000887629.1.58622 WP_000887629.1.58657 WP_000887629.1.58680 WP_000887629.1.58692 WP_000887629.1.58705 WP_000887629.1.58707 WP_000887629.1.58723 WP_000887629.1.58737 WP_000887629.1.58867 WP_000887629.1.58870 WP_000887629.1.58901 WP_000887629.1.58940 WP_000887629.1.58942 WP_000887629.1.58951 WP_000887629.1.58958 WP_000887629.1.58976 WP_000887629.1.58977 WP_000887629.1.58983 WP_000887629.1.59024 WP_000887629.1.59026 WP_000887629.1.59035 WP_000887629.1.59038 WP_000887629.1.5906 WP_000887629.1.59073 WP_000887629.1.59083 WP_000887629.1.59119 WP_000887629.1.59174 WP_000887629.1.59190 WP_000887629.1.59199 WP_000887629.1.59218 WP_000887629.1.59263 WP_000887629.1.5927 WP_000887629.1.59280 WP_000887629.1.59291 WP_000887629.1.59292 WP_000887629.1.59293 WP_000887629.1.59302 WP_000887629.1.59306 WP_000887629.1.59359 WP_000887629.1.59374 WP_000887629.1.59395 WP_000887629.1.59396 WP_000887629.1.59407 WP_000887629.1.59409 WP_000887629.1.59413 WP_000887629.1.5942 WP_000887629.1.59423 WP_000887629.1.59425 WP_000887629.1.59426 WP_000887629.1.59434 WP_000887629.1.59470 WP_000887629.1.59491 WP_000887629.1.59513 WP_000887629.1.59533 WP_000887629.1.59553 WP_000887629.1.59572 WP_000887629.1.59577 WP_000887629.1.59579 WP_000887629.1.59590 WP_000887629.1.59611 WP_000887629.1.59613 WP_000887629.1.59621 WP_000887629.1.59638 WP_000887629.1.5965 WP_000887629.1.59660 WP_000887629.1.59679 WP_000887629.1.59689 WP_000887629.1.59699 WP_000887629.1.597 WP_000887629.1.59714 WP_000887629.1.59717 WP_000887629.1.59730 WP_000887629.1.59733 WP_000887629.1.59737 WP_000887629.1.59745 WP_000887629.1.59756 WP_000887629.1.59781 WP_000887629.1.59782 WP_000887629.1.59791 WP_000887629.1.59823 WP_000887629.1.59836 WP_000887629.1.59838 WP_000887629.1.59855 WP_000887629.1.59858 WP_000887629.1.59894 WP_000887629.1.5990 WP_000887629.1.59905 WP_000887629.1.59912 WP_000887629.1.59914 WP_000887629.1.59932 WP_000887629.1.59959 WP_000887629.1.59980 WP_000887629.1.59981 WP_000887629.1.59998 WP_000887629.1.60005 WP_000887629.1.6002 WP_000887629.1.60031 WP_000887629.1.60042 WP_000887629.1.60043 WP_000887629.1.60070 WP_000887629.1.60095 WP_000887629.1.60096 WP_000887629.1.60110 WP_000887629.1.6013 WP_000887629.1.60133 WP_000887629.1.60151 WP_000887629.1.60186 WP_000887629.1.6022 WP_000887629.1.60228 WP_000887629.1.60235 WP_000887629.1.60246 WP_000887629.1.60304 WP_000887629.1.60325 WP_000887629.1.60337 WP_000887629.1.60350 WP_000887629.1.60373 WP_000887629.1.60374 WP_000887629.1.60387 WP_000887629.1.60436 WP_000887629.1.60443 WP_000887629.1.60453 WP_000887629.1.60457 WP_000887629.1.60461 WP_000887629.1.60477 WP_000887629.1.60491 WP_000887629.1.60498 WP_000887629.1.60505 WP_000887629.1.60550 WP_000887629.1.60559 WP_000887629.1.60567 WP_000887629.1.60570 WP_000887629.1.60591 WP_000887629.1.60599 WP_000887629.1.60606 WP_000887629.1.6061 WP_000887629.1.60613 WP_000887629.1.60614 WP_000887629.1.60630 WP_000887629.1.6064 WP_000887629.1.60644 WP_000887629.1.60647 WP_000887629.1.60654 WP_000887629.1.6066 WP_000887629.1.60671 WP_000887629.1.60684 WP_000887629.1.60698 WP_000887629.1.60717 WP_000887629.1.60732 WP_000887629.1.60744 WP_000887629.1.60761 WP_000887629.1.60764 WP_000887629.1.60771 WP_000887629.1.60816 WP_000887629.1.60826 WP_000887629.1.60832 WP_000887629.1.60835 WP_000887629.1.60847 WP_000887629.1.60872 WP_000887629.1.60895 WP_000887629.1.60901 WP_000887629.1.60921 WP_000887629.1.60925 WP_000887629.1.60927 WP_000887629.1.6094 WP_000887629.1.60974 WP_000887629.1.61005 WP_000887629.1.61008 WP_000887629.1.61035 WP_000887629.1.61039 WP_000887629.1.61046 WP_000887629.1.6106 WP_000887629.1.61096 WP_000887629.1.61097 WP_000887629.1.61099 WP_000887629.1.6110 WP_000887629.1.61102 WP_000887629.1.61108 WP_000887629.1.61112 WP_000887629.1.61121 WP_000887629.1.61148 WP_000887629.1.61170 WP_000887629.1.61174 WP_000887629.1.61181 WP_000887629.1.61183 WP_000887629.1.61186 WP_000887629.1.61223 WP_000887629.1.61225 WP_000887629.1.61241 WP_000887629.1.61245 WP_000887629.1.61253 WP_000887629.1.61268 WP_000887629.1.61292 WP_000887629.1.613 WP_000887629.1.61360 WP_000887629.1.61362 WP_000887629.1.61373 WP_000887629.1.6138 WP_000887629.1.61398 WP_000887629.1.61442 WP_000887629.1.61445 WP_000887629.1.61480 WP_000887629.1.61496 WP_000887629.1.61505 WP_000887629.1.61512 WP_000887629.1.61517 WP_000887629.1.61524 WP_000887629.1.61551 WP_000887629.1.61608 WP_000887629.1.61612 WP_000887629.1.61623 WP_000887629.1.61636 WP_000887629.1.61643 WP_000887629.1.61663 WP_000887629.1.61703 WP_000887629.1.61718 WP_000887629.1.61739 WP_000887629.1.61758 WP_000887629.1.61772 WP_000887629.1.61779 WP_000887629.1.618 WP_000887629.1.61806 WP_000887629.1.61822 WP_000887629.1.61835 WP_000887629.1.61853 WP_000887629.1.61858 WP_000887629.1.61874 WP_000887629.1.61893 WP_000887629.1.61926 WP_000887629.1.61939 WP_000887629.1.61948 WP_000887629.1.61949 WP_000887629.1.61955 WP_000887629.1.61957 WP_000887629.1.61966 WP_000887629.1.62038 WP_000887629.1.62043 WP_000887629.1.62099 WP_000887629.1.62102 WP_000887629.1.62135 WP_000887629.1.62157 WP_000887629.1.62182 WP_000887629.1.62236 WP_000887629.1.62264 WP_000887629.1.62266 WP_000887629.1.62273 WP_000887629.1.62282 WP_000887629.1.62290 WP_000887629.1.62296 WP_000887629.1.62303 WP_000887629.1.62337 WP_000887629.1.62348 WP_000887629.1.62358 WP_000887629.1.62447 WP_000887629.1.6245 WP_000887629.1.62454 WP_000887629.1.62460 WP_000887629.1.62480 WP_000887629.1.62481 WP_000887629.1.62487 WP_000887629.1.62503 WP_000887629.1.62507 WP_000887629.1.62513 WP_000887629.1.62514 WP_000887629.1.62529 WP_000887629.1.62541 WP_000887629.1.62555 WP_000887629.1.6261 WP_000887629.1.62612 WP_000887629.1.62642 WP_000887629.1.62646 WP_000887629.1.62675 WP_000887629.1.62681 WP_000887629.1.62714 WP_000887629.1.62735 WP_000887629.1.62750 WP_000887629.1.62762 WP_000887629.1.62769 WP_000887629.1.62780 WP_000887629.1.62787 WP_000887629.1.62788 WP_000887629.1.62802 WP_000887629.1.62812 WP_000887629.1.62818 WP_000887629.1.62819 WP_000887629.1.6282 WP_000887629.1.62840 WP_000887629.1.62843 WP_000887629.1.62850 WP_000887629.1.62851 WP_000887629.1.62866 WP_000887629.1.62885 WP_000887629.1.62888 WP_000887629.1.62914 WP_000887629.1.62919 WP_000887629.1.6293 WP_000887629.1.62931 WP_000887629.1.62951 WP_000887629.1.62959 WP_000887629.1.62973 WP_000887629.1.62989 WP_000887629.1.6299 WP_000887629.1.62992 WP_000887629.1.63023 WP_000887629.1.63078 WP_000887629.1.63167 WP_000887629.1.63177 WP_000887629.1.63189 WP_000887629.1.6323 WP_000887629.1.63246 WP_000887629.1.63271 WP_000887629.1.63305 WP_000887629.1.6331 WP_000887629.1.63330 WP_000887629.1.6334 WP_000887629.1.6337 WP_000887629.1.63370 WP_000887629.1.63374 WP_000887629.1.63433 WP_000887629.1.63437 WP_000887629.1.63445 WP_000887629.1.63453 WP_000887629.1.63466 WP_000887629.1.63467 WP_000887629.1.63470 WP_000887629.1.63478 WP_000887629.1.63484 WP_000887629.1.63487 WP_000887629.1.63491 WP_000887629.1.63496 WP_000887629.1.63536 WP_000887629.1.63556 WP_000887629.1.63563 WP_000887629.1.63576 WP_000887629.1.63586 WP_000887629.1.63602 WP_000887629.1.63615 WP_000887629.1.6364 WP_000887629.1.63666 WP_000887629.1.63679 WP_000887629.1.63683 WP_000887629.1.63703 WP_000887629.1.63721 WP_000887629.1.63746 WP_000887629.1.63800 WP_000887629.1.63810 WP_000887629.1.63814 WP_000887629.1.63821 WP_000887629.1.63871 WP_000887629.1.63944 WP_000887629.1.63957 WP_000887629.1.63964 WP_000887629.1.63990 WP_000887629.1.64008 WP_000887629.1.64014 WP_000887629.1.64030 WP_000887629.1.64040 WP_000887629.1.64045 WP_000887629.1.64050 WP_000887629.1.64053 WP_000887629.1.64074 WP_000887629.1.64080 WP_000887629.1.64086 WP_000887629.1.64110 WP_000887629.1.64138 WP_000887629.1.64150 WP_000887629.1.6416 WP_000887629.1.64161 WP_000887629.1.64165 WP_000887629.1.64175 WP_000887629.1.64190 WP_000887629.1.64193 WP_000887629.1.64280 WP_000887629.1.64285 WP_000887629.1.64286 WP_000887629.1.6431 WP_000887629.1.64312 WP_000887629.1.64321 WP_000887629.1.64337 WP_000887629.1.64353 WP_000887629.1.64356 WP_000887629.1.64371 WP_000887629.1.64380 WP_000887629.1.64391 WP_000887629.1.6441 WP_000887629.1.64417 WP_000887629.1.64437 WP_000887629.1.64438 WP_000887629.1.64448 WP_000887629.1.6445 WP_000887629.1.64458 WP_000887629.1.6446 WP_000887629.1.64519 WP_000887629.1.64528 WP_000887629.1.64540 WP_000887629.1.64547 WP_000887629.1.64563 WP_000887629.1.64621 WP_000887629.1.64634 WP_000887629.1.64657 WP_000887629.1.6469 WP_000887629.1.64693 WP_000887629.1.647 WP_000887629.1.64707 WP_000887629.1.64712 WP_000887629.1.64746 WP_000887629.1.64749 WP_000887629.1.64784 WP_000887629.1.64789 WP_000887629.1.64821 WP_000887629.1.64840 WP_000887629.1.64866 WP_000887629.1.64875 WP_000887629.1.64881 WP_000887629.1.64895 WP_000887629.1.64912 WP_000887629.1.64939 WP_000887629.1.64946 WP_000887629.1.64970 WP_000887629.1.6499 WP_000887629.1.64990 WP_000887629.1.65023 WP_000887629.1.65035 WP_000887629.1.65040 WP_000887629.1.65056 WP_000887629.1.65084 WP_000887629.1.651 WP_000887629.1.6511 WP_000887629.1.65110 WP_000887629.1.65114 WP_000887629.1.65118 WP_000887629.1.65122 WP_000887629.1.65135 WP_000887629.1.65151 WP_000887629.1.65155 WP_000887629.1.6516 WP_000887629.1.65179 WP_000887629.1.65192 WP_000887629.1.65194 WP_000887629.1.65206 WP_000887629.1.65240 WP_000887629.1.65271 WP_000887629.1.65286 WP_000887629.1.65296 WP_000887629.1.65305 WP_000887629.1.65306 WP_000887629.1.65353 WP_000887629.1.65355 WP_000887629.1.65364 WP_000887629.1.6537 WP_000887629.1.65370 WP_000887629.1.654 WP_000887629.1.65405 WP_000887629.1.65408 WP_000887629.1.65413 WP_000887629.1.65415 WP_000887629.1.65493 WP_000887629.1.6553 WP_000887629.1.65531 WP_000887629.1.65546 WP_000887629.1.65571 WP_000887629.1.65581 WP_000887629.1.65606 WP_000887629.1.6563 WP_000887629.1.65667 WP_000887629.1.65672 WP_000887629.1.65677 WP_000887629.1.65708 WP_000887629.1.65714 WP_000887629.1.65749 WP_000887629.1.65762 WP_000887629.1.6587 WP_000887629.1.65875 WP_000887629.1.65898 WP_000887629.1.65912 WP_000887629.1.65954 WP_000887629.1.65961 WP_000887629.1.65962 WP_000887629.1.65963 WP_000887629.1.65988 WP_000887629.1.6599 WP_000887629.1.65991 WP_000887629.1.66001 WP_000887629.1.66007 WP_000887629.1.66016 WP_000887629.1.66017 WP_000887629.1.66022 WP_000887629.1.66033 WP_000887629.1.6604 WP_000887629.1.66044 WP_000887629.1.66050 WP_000887629.1.66071 WP_000887629.1.6609 WP_000887629.1.66094 WP_000887629.1.66100 WP_000887629.1.66102 WP_000887629.1.66104 WP_000887629.1.66105 WP_000887629.1.66121 WP_000887629.1.66127 WP_000887629.1.6618 WP_000887629.1.66181 WP_000887629.1.66187 WP_000887629.1.66197 WP_000887629.1.6622 WP_000887629.1.66251 WP_000887629.1.66255 WP_000887629.1.66264 WP_000887629.1.66280 WP_000887629.1.66288 WP_000887629.1.66290 WP_000887629.1.66327 WP_000887629.1.66335 WP_000887629.1.6635 WP_000887629.1.66376 WP_000887629.1.66387 WP_000887629.1.66389 WP_000887629.1.66392 WP_000887629.1.66395 WP_000887629.1.66412 WP_000887629.1.66421 WP_000887629.1.66432 WP_000887629.1.6645 WP_000887629.1.66501 WP_000887629.1.66511 WP_000887629.1.66523 WP_000887629.1.66531 WP_000887629.1.6654 WP_000887629.1.66550 WP_000887629.1.66559 WP_000887629.1.66566 WP_000887629.1.66579 WP_000887629.1.66624 WP_000887629.1.66644 WP_000887629.1.6665 WP_000887629.1.66667 WP_000887629.1.66668 WP_000887629.1.66700 WP_000887629.1.66708 WP_000887629.1.66719 WP_000887629.1.66727 WP_000887629.1.66758 WP_000887629.1.6676 WP_000887629.1.66783 WP_000887629.1.66791 WP_000887629.1.66795 WP_000887629.1.66796 WP_000887629.1.66849 WP_000887629.1.66926 WP_000887629.1.66933 WP_000887629.1.66948 WP_000887629.1.66975 WP_000887629.1.6698 WP_000887629.1.66984 WP_000887629.1.67018 WP_000887629.1.67021 WP_000887629.1.67022 WP_000887629.1.67026 WP_000887629.1.67047 WP_000887629.1.67055 WP_000887629.1.6706 WP_000887629.1.67073 WP_000887629.1.67102 WP_000887629.1.67116 WP_000887629.1.67120 WP_000887629.1.67136 WP_000887629.1.67137 WP_000887629.1.67149 WP_000887629.1.67150 WP_000887629.1.67153 WP_000887629.1.67174 WP_000887629.1.67193 WP_000887629.1.67194 WP_000887629.1.67200 WP_000887629.1.67209 WP_000887629.1.67210 WP_000887629.1.67214 WP_000887629.1.6723 WP_000887629.1.67258 WP_000887629.1.67278 WP_000887629.1.67284 WP_000887629.1.67293 WP_000887629.1.6735 WP_000887629.1.67373 WP_000887629.1.67383 WP_000887629.1.67415 WP_000887629.1.67427 WP_000887629.1.67446 WP_000887629.1.67451 WP_000887629.1.67452 WP_000887629.1.67454 WP_000887629.1.67456 WP_000887629.1.67462 WP_000887629.1.67464 WP_000887629.1.67467 WP_000887629.1.67468 WP_000887629.1.67495 WP_000887629.1.67522 WP_000887629.1.67533 WP_000887629.1.67538 WP_000887629.1.67549 WP_000887629.1.67553 WP_000887629.1.67581 WP_000887629.1.67606 WP_000887629.1.67660 WP_000887629.1.67663 WP_000887629.1.67676 WP_000887629.1.67681 WP_000887629.1.67685 WP_000887629.1.6769 WP_000887629.1.67701 WP_000887629.1.67704 WP_000887629.1.67724 WP_000887629.1.67726 WP_000887629.1.67737 WP_000887629.1.67753 WP_000887629.1.67758 WP_000887629.1.67760 WP_000887629.1.67775 WP_000887629.1.67780 WP_000887629.1.67787 WP_000887629.1.678 WP_000887629.1.67841 WP_000887629.1.67853 WP_000887629.1.67861 WP_000887629.1.67894 WP_000887629.1.67901 WP_000887629.1.6793 WP_000887629.1.67938 WP_000887629.1.67975 WP_000887629.1.67984 WP_000887629.1.67990 WP_000887629.1.67999 WP_000887629.1.68011 WP_000887629.1.68012 WP_000887629.1.6802 WP_000887629.1.68025 WP_000887629.1.6803 WP_000887629.1.68039 WP_000887629.1.68053 WP_000887629.1.68058 WP_000887629.1.68059 WP_000887629.1.68063 WP_000887629.1.68067 WP_000887629.1.68069 WP_000887629.1.68070 WP_000887629.1.68079 WP_000887629.1.68096 WP_000887629.1.68108 WP_000887629.1.68126 WP_000887629.1.68138 WP_000887629.1.6814 WP_000887629.1.68145 WP_000887629.1.68170 WP_000887629.1.68175 WP_000887629.1.68177 WP_000887629.1.682 WP_000887629.1.68215 WP_000887629.1.68231 WP_000887629.1.68241 WP_000887629.1.68271 WP_000887629.1.68278 WP_000887629.1.68281 WP_000887629.1.68283 WP_000887629.1.68292 WP_000887629.1.68300 WP_000887629.1.68336 WP_000887629.1.68341 WP_000887629.1.68347 WP_000887629.1.68362 WP_000887629.1.68369 WP_000887629.1.68372 WP_000887629.1.68396 WP_000887629.1.68411 WP_000887629.1.68441 WP_000887629.1.68442 WP_000887629.1.68482 WP_000887629.1.68490 WP_000887629.1.68493 WP_000887629.1.68523 WP_000887629.1.68524 WP_000887629.1.68534 WP_000887629.1.68572 WP_000887629.1.68584 WP_000887629.1.6859 WP_000887629.1.68598 WP_000887629.1.6860 WP_000887629.1.68609 WP_000887629.1.68630 WP_000887629.1.68632 WP_000887629.1.68635 WP_000887629.1.68673 WP_000887629.1.68678 WP_000887629.1.68679 WP_000887629.1.68695 WP_000887629.1.68697 WP_000887629.1.68701 WP_000887629.1.68711 WP_000887629.1.68731 WP_000887629.1.68735 WP_000887629.1.68751 WP_000887629.1.68752 WP_000887629.1.6877 WP_000887629.1.68793 WP_000887629.1.68795 WP_000887629.1.68797 WP_000887629.1.6880 WP_000887629.1.68801 WP_000887629.1.68847 WP_000887629.1.68865 WP_000887629.1.6887 WP_000887629.1.68873 WP_000887629.1.68877 WP_000887629.1.68880 WP_000887629.1.68911 WP_000887629.1.68936 WP_000887629.1.68942 WP_000887629.1.68956 WP_000887629.1.68961 WP_000887629.1.68989 WP_000887629.1.68995 WP_000887629.1.69039 WP_000887629.1.69054 WP_000887629.1.69098 WP_000887629.1.69126 WP_000887629.1.69127 WP_000887629.1.69158 WP_000887629.1.6916 WP_000887629.1.6919 WP_000887629.1.69192 WP_000887629.1.6921 WP_000887629.1.6923 WP_000887629.1.69247 WP_000887629.1.69258 WP_000887629.1.69261 WP_000887629.1.6929 WP_000887629.1.69303 WP_000887629.1.69305 WP_000887629.1.69327 WP_000887629.1.69341 WP_000887629.1.69350 WP_000887629.1.69351 WP_000887629.1.69390 WP_000887629.1.694 WP_000887629.1.69441 WP_000887629.1.6945 WP_000887629.1.69472 WP_000887629.1.69473 WP_000887629.1.69502 WP_000887629.1.69506 WP_000887629.1.69537 WP_000887629.1.69551 WP_000887629.1.69569 WP_000887629.1.69583 WP_000887629.1.69589 WP_000887629.1.69593 WP_000887629.1.69643 WP_000887629.1.69646 WP_000887629.1.69649 WP_000887629.1.69655 WP_000887629.1.69689 WP_000887629.1.69716 WP_000887629.1.69730 WP_000887629.1.69780 WP_000887629.1.69803 WP_000887629.1.69810 WP_000887629.1.69818 WP_000887629.1.69872 WP_000887629.1.69887 WP_000887629.1.69896 WP_000887629.1.6993 WP_000887629.1.69972 WP_000887629.1.69979 WP_000887629.1.7001 WP_000887629.1.70063 WP_000887629.1.70081 WP_000887629.1.70123 WP_000887629.1.70149 WP_000887629.1.70190 WP_000887629.1.70200 WP_000887629.1.70300 WP_000887629.1.70337 WP_000887629.1.70357 WP_000887629.1.70386 WP_000887629.1.70407 WP_000887629.1.70408 WP_000887629.1.70414 WP_000887629.1.70477 WP_000887629.1.70492 WP_000887629.1.7050 WP_000887629.1.70509 WP_000887629.1.70517 WP_000887629.1.7052 WP_000887629.1.70530 WP_000887629.1.70539 WP_000887629.1.70563 WP_000887629.1.70576 WP_000887629.1.70578 WP_000887629.1.70582 WP_000887629.1.70600 WP_000887629.1.70628 WP_000887629.1.70655 WP_000887629.1.70656 WP_000887629.1.70686 WP_000887629.1.70694 WP_000887629.1.70698 WP_000887629.1.70705 WP_000887629.1.70713 WP_000887629.1.70723 WP_000887629.1.70728 WP_000887629.1.70745 WP_000887629.1.70747 WP_000887629.1.70748 WP_000887629.1.70767 WP_000887629.1.70787 WP_000887629.1.70794 WP_000887629.1.70803 WP_000887629.1.70880 WP_000887629.1.7090 WP_000887629.1.70900 WP_000887629.1.70952 WP_000887629.1.70967 WP_000887629.1.7102 WP_000887629.1.71024 WP_000887629.1.71037 WP_000887629.1.71042 WP_000887629.1.71062 WP_000887629.1.71099 WP_000887629.1.71109 WP_000887629.1.71113 WP_000887629.1.71134 WP_000887629.1.71139 WP_000887629.1.71144 WP_000887629.1.71147 WP_000887629.1.71149 WP_000887629.1.71159 WP_000887629.1.71162 WP_000887629.1.71170 WP_000887629.1.71176 WP_000887629.1.71183 WP_000887629.1.71192 WP_000887629.1.71199 WP_000887629.1.71205 WP_000887629.1.71221 WP_000887629.1.71223 WP_000887629.1.71225 WP_000887629.1.71229 WP_000887629.1.71264 WP_000887629.1.71269 WP_000887629.1.71272 WP_000887629.1.71273 WP_000887629.1.71275 WP_000887629.1.71285 WP_000887629.1.71294 WP_000887629.1.71311 WP_000887629.1.71312 WP_000887629.1.71315 WP_000887629.1.71323 WP_000887629.1.71339 WP_000887629.1.71354 WP_000887629.1.71397 WP_000887629.1.71403 WP_000887629.1.71409 WP_000887629.1.71423 WP_000887629.1.71448 WP_000887629.1.7147 WP_000887629.1.71480 WP_000887629.1.71522 WP_000887629.1.71533 WP_000887629.1.71537 WP_000887629.1.71540 WP_000887629.1.71560 WP_000887629.1.71562 WP_000887629.1.71563 WP_000887629.1.71603 WP_000887629.1.71607 WP_000887629.1.71632 WP_000887629.1.71680 WP_000887629.1.71690 WP_000887629.1.71695 WP_000887629.1.71712 WP_000887629.1.71732 WP_000887629.1.71783 WP_000887629.1.71830 WP_000887629.1.71832 WP_000887629.1.71837 WP_000887629.1.71840 WP_000887629.1.71855 WP_000887629.1.71856 WP_000887629.1.71874 WP_000887629.1.71912 WP_000887629.1.7192 WP_000887629.1.71922 WP_000887629.1.71938 WP_000887629.1.71940 WP_000887629.1.71944 WP_000887629.1.71945 WP_000887629.1.71972 WP_000887629.1.71975 WP_000887629.1.71987 WP_000887629.1.72013 WP_000887629.1.72016 WP_000887629.1.72021 WP_000887629.1.72028 WP_000887629.1.72033 WP_000887629.1.72048 WP_000887629.1.72053 WP_000887629.1.72054 WP_000887629.1.72066 WP_000887629.1.72090 WP_000887629.1.72098 WP_000887629.1.7210 WP_000887629.1.72120 WP_000887629.1.72125 WP_000887629.1.72126 WP_000887629.1.72141 WP_000887629.1.72153 WP_000887629.1.72155 WP_000887629.1.72157 WP_000887629.1.72162 WP_000887629.1.72180 WP_000887629.1.72184 WP_000887629.1.72186 WP_000887629.1.72208 WP_000887629.1.72212 WP_000887629.1.72237 WP_000887629.1.72240 WP_000887629.1.7225 WP_000887629.1.72262 WP_000887629.1.72270 WP_000887629.1.72279 WP_000887629.1.72293 WP_000887629.1.72298 WP_000887629.1.72316 WP_000887629.1.72322 WP_000887629.1.72337 WP_000887629.1.72359 WP_000887629.1.72362 WP_000887629.1.72388 WP_000887629.1.72391 WP_000887629.1.72392 WP_000887629.1.72397 WP_000887629.1.72414 WP_000887629.1.72427 WP_000887629.1.72431 WP_000887629.1.72436 WP_000887629.1.72485 WP_000887629.1.72493 WP_000887629.1.72507 WP_000887629.1.72511 WP_000887629.1.72521 WP_000887629.1.72522 WP_000887629.1.72535 WP_000887629.1.72537 WP_000887629.1.72574 WP_000887629.1.72582 WP_000887629.1.72588 WP_000887629.1.72593 WP_000887629.1.72596 WP_000887629.1.72608 WP_000887629.1.72614 WP_000887629.1.72615 WP_000887629.1.72616 WP_000887629.1.72619 WP_000887629.1.72641 WP_000887629.1.72643 WP_000887629.1.72651 WP_000887629.1.72663 WP_000887629.1.72694 WP_000887629.1.72695 WP_000887629.1.72700 WP_000887629.1.72706 WP_000887629.1.72725 WP_000887629.1.72729 WP_000887629.1.72738 WP_000887629.1.72745 WP_000887629.1.72747 WP_000887629.1.72751 WP_000887629.1.72758 WP_000887629.1.72764 WP_000887629.1.7277 WP_000887629.1.72778 WP_000887629.1.72804 WP_000887629.1.72806 WP_000887629.1.7281 WP_000887629.1.72837 WP_000887629.1.72858 WP_000887629.1.72860 WP_000887629.1.72869 WP_000887629.1.72893 WP_000887629.1.7291 WP_000887629.1.72910 WP_000887629.1.72913 WP_000887629.1.72947 WP_000887629.1.72950 WP_000887629.1.72956 WP_000887629.1.72998 WP_000887629.1.73010 WP_000887629.1.73015 WP_000887629.1.73032 WP_000887629.1.73039 WP_000887629.1.73061 WP_000887629.1.73072 WP_000887629.1.73075 WP_000887629.1.73085 WP_000887629.1.7309 WP_000887629.1.73094 WP_000887629.1.73126 WP_000887629.1.73129 WP_000887629.1.73193 WP_000887629.1.73197 WP_000887629.1.73215 WP_000887629.1.73217 WP_000887629.1.73230 WP_000887629.1.73239 WP_000887629.1.73249 WP_000887629.1.73251 WP_000887629.1.73257 WP_000887629.1.73259 WP_000887629.1.73278 WP_000887629.1.73291 WP_000887629.1.73292 WP_000887629.1.73295 WP_000887629.1.73326 WP_000887629.1.73333 WP_000887629.1.73340 WP_000887629.1.73343 WP_000887629.1.73344 WP_000887629.1.73349 WP_000887629.1.73385 WP_000887629.1.73428 WP_000887629.1.7345 WP_000887629.1.73486 WP_000887629.1.7349 WP_000887629.1.73498 WP_000887629.1.73524 WP_000887629.1.73565 WP_000887629.1.73592 WP_000887629.1.73604 WP_000887629.1.73626 WP_000887629.1.73631 WP_000887629.1.73652 WP_000887629.1.73663 WP_000887629.1.73700 WP_000887629.1.73709 WP_000887629.1.73717 WP_000887629.1.73743 WP_000887629.1.73748 WP_000887629.1.7376 WP_000887629.1.73783 WP_000887629.1.73785 WP_000887629.1.73797 WP_000887629.1.73801 WP_000887629.1.73807 WP_000887629.1.73811 WP_000887629.1.73835 WP_000887629.1.73844 WP_000887629.1.73846 WP_000887629.1.73859 WP_000887629.1.73882 WP_000887629.1.73897 WP_000887629.1.73908 WP_000887629.1.7392 WP_000887629.1.73934 WP_000887629.1.73942 WP_000887629.1.73968 WP_000887629.1.73980 WP_000887629.1.73992 WP_000887629.1.73995 WP_000887629.1.73996 WP_000887629.1.74046 WP_000887629.1.74051 WP_000887629.1.74053 WP_000887629.1.7407 WP_000887629.1.7411 WP_000887629.1.74123 WP_000887629.1.7413 WP_000887629.1.74156 WP_000887629.1.74184 WP_000887629.1.74185 WP_000887629.1.74213 WP_000887629.1.74223 WP_000887629.1.7424 WP_000887629.1.74243 WP_000887629.1.7425 WP_000887629.1.74251 WP_000887629.1.7429 WP_000887629.1.74294 WP_000887629.1.74309 WP_000887629.1.74358 WP_000887629.1.74365 WP_000887629.1.74367 WP_000887629.1.744 WP_000887629.1.74423 WP_000887629.1.74426 WP_000887629.1.74431 WP_000887629.1.74444 WP_000887629.1.74445 WP_000887629.1.7446 WP_000887629.1.74465 WP_000887629.1.74478 WP_000887629.1.74491 WP_000887629.1.74501 WP_000887629.1.74513 WP_000887629.1.74520 WP_000887629.1.74521 WP_000887629.1.74528 WP_000887629.1.74532 WP_000887629.1.74536 WP_000887629.1.74549 WP_000887629.1.74557 WP_000887629.1.7461 WP_000887629.1.74611 WP_000887629.1.74623 WP_000887629.1.74624 WP_000887629.1.74625 WP_000887629.1.74652 WP_000887629.1.74670 WP_000887629.1.74687 WP_000887629.1.74688 WP_000887629.1.74689 WP_000887629.1.74691 WP_000887629.1.74705 WP_000887629.1.7471 WP_000887629.1.74713 WP_000887629.1.74716 WP_000887629.1.74720 WP_000887629.1.74735 WP_000887629.1.7475 WP_000887629.1.74752 WP_000887629.1.74765 WP_000887629.1.74767 WP_000887629.1.7478 WP_000887629.1.7479 WP_000887629.1.74793 WP_000887629.1.74811 WP_000887629.1.74828 WP_000887629.1.74844 WP_000887629.1.74852 WP_000887629.1.74854 WP_000887629.1.74867 WP_000887629.1.74873 WP_000887629.1.74879 WP_000887629.1.74880 WP_000887629.1.74885 WP_000887629.1.74889 WP_000887629.1.74914 WP_000887629.1.74962 WP_000887629.1.74975 WP_000887629.1.74993 WP_000887629.1.74998 WP_000887629.1.75003 WP_000887629.1.75021 WP_000887629.1.75029 WP_000887629.1.75030 WP_000887629.1.75087 WP_000887629.1.75112 WP_000887629.1.75136 WP_000887629.1.75138 WP_000887629.1.75139 WP_000887629.1.75143 WP_000887629.1.75145 WP_000887629.1.75149 WP_000887629.1.75155 WP_000887629.1.7516 WP_000887629.1.75164 WP_000887629.1.75181 WP_000887629.1.75219 WP_000887629.1.75221 WP_000887629.1.75243 WP_000887629.1.75247 WP_000887629.1.75248 WP_000887629.1.75254 WP_000887629.1.75270 WP_000887629.1.75272 WP_000887629.1.7536 WP_000887629.1.75360 WP_000887629.1.75367 WP_000887629.1.75382 WP_000887629.1.7539 WP_000887629.1.75419 WP_000887629.1.75428 WP_000887629.1.75465 WP_000887629.1.75491 WP_000887629.1.75507 WP_000887629.1.75515 WP_000887629.1.75529 WP_000887629.1.75536 WP_000887629.1.75568 WP_000887629.1.75577 WP_000887629.1.75588 WP_000887629.1.75594 WP_000887629.1.75602 WP_000887629.1.75612 WP_000887629.1.75629 WP_000887629.1.75644 WP_000887629.1.75653 WP_000887629.1.75672 WP_000887629.1.75676 WP_000887629.1.75679 WP_000887629.1.75687 WP_000887629.1.75694 WP_000887629.1.75696 WP_000887629.1.75698 WP_000887629.1.75699 WP_000887629.1.75735 WP_000887629.1.75758 WP_000887629.1.75767 WP_000887629.1.75803 WP_000887629.1.7583 WP_000887629.1.75922 WP_000887629.1.7597 WP_000887629.1.75973 WP_000887629.1.75983 WP_000887629.1.75989 WP_000887629.1.75995 WP_000887629.1.75999 WP_000887629.1.76005 WP_000887629.1.76009 WP_000887629.1.76019 WP_000887629.1.7603 WP_000887629.1.76030 WP_000887629.1.76036 WP_000887629.1.76039 WP_000887629.1.76054 WP_000887629.1.76057 WP_000887629.1.7608 WP_000887629.1.76087 WP_000887629.1.76089 WP_000887629.1.76103 WP_000887629.1.76118 WP_000887629.1.76129 WP_000887629.1.7613 WP_000887629.1.76152 WP_000887629.1.7617 WP_000887629.1.76184 WP_000887629.1.76189 WP_000887629.1.76194 WP_000887629.1.76196 WP_000887629.1.76211 WP_000887629.1.76237 WP_000887629.1.76312 WP_000887629.1.76325 WP_000887629.1.76335 WP_000887629.1.76361 WP_000887629.1.7637 WP_000887629.1.76384 WP_000887629.1.76390 WP_000887629.1.76407 WP_000887629.1.76446 WP_000887629.1.76448 WP_000887629.1.76452 WP_000887629.1.76462 WP_000887629.1.76466 WP_000887629.1.76477 WP_000887629.1.76542 WP_000887629.1.76544 WP_000887629.1.76547 WP_000887629.1.76562 WP_000887629.1.76595 WP_000887629.1.7661 WP_000887629.1.76612 WP_000887629.1.76619 WP_000887629.1.76656 WP_000887629.1.76697 WP_000887629.1.76701 WP_000887629.1.76705 WP_000887629.1.76707 WP_000887629.1.76712 WP_000887629.1.76751 WP_000887629.1.76759 WP_000887629.1.76815 WP_000887629.1.76827 WP_000887629.1.76840 WP_000887629.1.76863 WP_000887629.1.76884 WP_000887629.1.76909 WP_000887629.1.76918 WP_000887629.1.76948 WP_000887629.1.76965 WP_000887629.1.76966 WP_000887629.1.7699 WP_000887629.1.76994 WP_000887629.1.77007 WP_000887629.1.77015 WP_000887629.1.77022 WP_000887629.1.77042 WP_000887629.1.77070 WP_000887629.1.77081 WP_000887629.1.77099 WP_000887629.1.771 WP_000887629.1.77109 WP_000887629.1.77120 WP_000887629.1.77128 WP_000887629.1.77147 WP_000887629.1.77162 WP_000887629.1.77163 WP_000887629.1.77173 WP_000887629.1.77175 WP_000887629.1.77200 WP_000887629.1.77204 WP_000887629.1.77214 WP_000887629.1.77224 WP_000887629.1.77239 WP_000887629.1.77253 WP_000887629.1.77255 WP_000887629.1.77258 WP_000887629.1.77275 WP_000887629.1.7728 WP_000887629.1.77284 WP_000887629.1.77288 WP_000887629.1.7729 WP_000887629.1.77290 WP_000887629.1.77291 WP_000887629.1.7731 WP_000887629.1.77326 WP_000887629.1.77341 WP_000887629.1.77358 WP_000887629.1.77391 WP_000887629.1.77392 WP_000887629.1.77432 WP_000887629.1.77437 WP_000887629.1.77448 WP_000887629.1.77452 WP_000887629.1.77462 WP_000887629.1.7747 WP_000887629.1.77470 WP_000887629.1.77471 WP_000887629.1.77477 WP_000887629.1.77481 WP_000887629.1.77495 WP_000887629.1.775 WP_000887629.1.7750 WP_000887629.1.77503 WP_000887629.1.77511 WP_000887629.1.77551 WP_000887629.1.7756 WP_000887629.1.77581 WP_000887629.1.77595 WP_000887629.1.77600 WP_000887629.1.77608 WP_000887629.1.77626 WP_000887629.1.77636 WP_000887629.1.77644 WP_000887629.1.77648 WP_000887629.1.77657 WP_000887629.1.77707 WP_000887629.1.77725 WP_000887629.1.77741 WP_000887629.1.7775 WP_000887629.1.77760 WP_000887629.1.77767 WP_000887629.1.77768 WP_000887629.1.7780 WP_000887629.1.7781 WP_000887629.1.77826 WP_000887629.1.77833 WP_000887629.1.77876 WP_000887629.1.77929 WP_000887629.1.77949 WP_000887629.1.7795 WP_000887629.1.77961 WP_000887629.1.77979 WP_000887629.1.7799 WP_000887629.1.77999 WP_000887629.1.78000 WP_000887629.1.78007 WP_000887629.1.78010 WP_000887629.1.7804 WP_000887629.1.78059 WP_000887629.1.7806 WP_000887629.1.7808 WP_000887629.1.78089 WP_000887629.1.78097 WP_000887629.1.78099 WP_000887629.1.78101 WP_000887629.1.78102 WP_000887629.1.78196 WP_000887629.1.78202 WP_000887629.1.78235 WP_000887629.1.78297 WP_000887629.1.78305 WP_000887629.1.78321 WP_000887629.1.78323 WP_000887629.1.78337 WP_000887629.1.78340 WP_000887629.1.78376 WP_000887629.1.78390 WP_000887629.1.784 WP_000887629.1.78413 WP_000887629.1.78445 WP_000887629.1.78463 WP_000887629.1.7847 WP_000887629.1.78481 WP_000887629.1.78491 WP_000887629.1.7851 WP_000887629.1.78515 WP_000887629.1.7855 WP_000887629.1.78553 WP_000887629.1.78572 WP_000887629.1.78575 WP_000887629.1.78581 WP_000887629.1.78583 WP_000887629.1.78586 WP_000887629.1.78593 WP_000887629.1.78610 WP_000887629.1.78611 WP_000887629.1.78612 WP_000887629.1.78615 WP_000887629.1.78622 WP_000887629.1.78645 WP_000887629.1.78683 WP_000887629.1.78687 WP_000887629.1.78696 WP_000887629.1.78698 WP_000887629.1.78714 WP_000887629.1.78718 WP_000887629.1.78746 WP_000887629.1.78750 WP_000887629.1.78757 WP_000887629.1.78775 WP_000887629.1.78814 WP_000887629.1.7883 WP_000887629.1.78843 WP_000887629.1.78845 WP_000887629.1.78854 WP_000887629.1.78888 WP_000887629.1.78891 WP_000887629.1.78895 WP_000887629.1.78908 WP_000887629.1.78919 WP_000887629.1.78953 WP_000887629.1.78955 WP_000887629.1.7896 WP_000887629.1.78966 WP_000887629.1.7898 WP_000887629.1.79002 WP_000887629.1.79004 WP_000887629.1.7901 WP_000887629.1.79065 WP_000887629.1.79067 WP_000887629.1.79075 WP_000887629.1.79086 WP_000887629.1.79088 WP_000887629.1.79090 WP_000887629.1.79092 WP_000887629.1.79172 WP_000887629.1.79226 WP_000887629.1.79243 WP_000887629.1.79246 WP_000887629.1.79276 WP_000887629.1.79306 WP_000887629.1.79308 WP_000887629.1.79312 WP_000887629.1.79346 WP_000887629.1.79348 WP_000887629.1.79356 WP_000887629.1.79368 WP_000887629.1.79369 WP_000887629.1.7937 WP_000887629.1.79389 WP_000887629.1.7940 WP_000887629.1.79416 WP_000887629.1.79443 WP_000887629.1.79464 WP_000887629.1.79478 WP_000887629.1.79505 WP_000887629.1.79519 WP_000887629.1.7952 WP_000887629.1.79525 WP_000887629.1.79526 WP_000887629.1.79528 WP_000887629.1.79540 WP_000887629.1.79558 WP_000887629.1.79563 WP_000887629.1.79576 WP_000887629.1.79591 WP_000887629.1.79606 WP_000887629.1.79619 WP_000887629.1.79640 WP_000887629.1.7967 WP_000887629.1.79685 WP_000887629.1.79707 WP_000887629.1.79713 WP_000887629.1.79715 WP_000887629.1.79764 WP_000887629.1.79800 WP_000887629.1.79816 WP_000887629.1.79824 WP_000887629.1.79840 WP_000887629.1.7985 WP_000887629.1.79866 WP_000887629.1.79869 WP_000887629.1.7987 WP_000887629.1.79871 WP_000887629.1.79877 WP_000887629.1.79905 WP_000887629.1.79922 WP_000887629.1.7993 WP_000887629.1.79930 WP_000887629.1.79931 WP_000887629.1.79932 WP_000887629.1.79933 WP_000887629.1.79936 WP_000887629.1.79944 WP_000887629.1.79955 WP_000887629.1.79965 WP_000887629.1.79973 WP_000887629.1.79984 WP_000887629.1.80 WP_000887629.1.80011 WP_000887629.1.80016 WP_000887629.1.80026 WP_000887629.1.8004 WP_000887629.1.80043 WP_000887629.1.80050 WP_000887629.1.80060 WP_000887629.1.8007 WP_000887629.1.80071 WP_000887629.1.80096 WP_000887629.1.80106 WP_000887629.1.8011 WP_000887629.1.80112 WP_000887629.1.80136 WP_000887629.1.80141 WP_000887629.1.80168 WP_000887629.1.80176 WP_000887629.1.80179 WP_000887629.1.80192 WP_000887629.1.80255 WP_000887629.1.80292 WP_000887629.1.80309 WP_000887629.1.80310 WP_000887629.1.80320 WP_000887629.1.80330 WP_000887629.1.80343 WP_000887629.1.80388 WP_000887629.1.80392 WP_000887629.1.804 WP_000887629.1.80402 WP_000887629.1.80426 WP_000887629.1.80428 WP_000887629.1.80440 WP_000887629.1.80456 WP_000887629.1.80484 WP_000887629.1.80517 WP_000887629.1.80519 WP_000887629.1.80524 WP_000887629.1.80545 WP_000887629.1.80558 WP_000887629.1.8057 WP_000887629.1.80577 WP_000887629.1.80578 WP_000887629.1.80594 WP_000887629.1.80606 WP_000887629.1.80612 WP_000887629.1.80626 WP_000887629.1.80662 WP_000887629.1.80666 WP_000887629.1.80676 WP_000887629.1.8068 WP_000887629.1.80709 WP_000887629.1.80731 WP_000887629.1.80736 WP_000887629.1.80737 WP_000887629.1.8074 WP_000887629.1.80754 WP_000887629.1.80756 WP_000887629.1.8076 WP_000887629.1.80768 WP_000887629.1.80789 WP_000887629.1.808 WP_000887629.1.80804 WP_000887629.1.80805 WP_000887629.1.80843 WP_000887629.1.80882 WP_000887629.1.80884 WP_000887629.1.80894 WP_000887629.1.8090 WP_000887629.1.8091 WP_000887629.1.80945 WP_000887629.1.80946 WP_000887629.1.80954 WP_000887629.1.80983 WP_000887629.1.80985 WP_000887629.1.810 WP_000887629.1.81026 WP_000887629.1.81032 WP_000887629.1.81034 WP_000887629.1.81036 WP_000887629.1.81054 WP_000887629.1.81056 WP_000887629.1.81070 WP_000887629.1.81071 WP_000887629.1.811 WP_000887629.1.81104 WP_000887629.1.81120 WP_000887629.1.81127 WP_000887629.1.81141 WP_000887629.1.81160 WP_000887629.1.81165 WP_000887629.1.81180 WP_000887629.1.81182 WP_000887629.1.8121 WP_000887629.1.81219 WP_000887629.1.81267 WP_000887629.1.81273 WP_000887629.1.81281 WP_000887629.1.81283 WP_000887629.1.81286 WP_000887629.1.8129 WP_000887629.1.81298 WP_000887629.1.81313 WP_000887629.1.81316 WP_000887629.1.81347 WP_000887629.1.81376 WP_000887629.1.81391 WP_000887629.1.81396 WP_000887629.1.81418 WP_000887629.1.81420 WP_000887629.1.81442 WP_000887629.1.81469 WP_000887629.1.81475 WP_000887629.1.81484 WP_000887629.1.81514 WP_000887629.1.81517 WP_000887629.1.8156 WP_000887629.1.81576 WP_000887629.1.81577 WP_000887629.1.81580 WP_000887629.1.81588 WP_000887629.1.81589 WP_000887629.1.81596 WP_000887629.1.81602 WP_000887629.1.81618 WP_000887629.1.81624 WP_000887629.1.81625 WP_000887629.1.81688 WP_000887629.1.81692 WP_000887629.1.81715 WP_000887629.1.81723 WP_000887629.1.81754 WP_000887629.1.81806 WP_000887629.1.81819 WP_000887629.1.81832 WP_000887629.1.81869 WP_000887629.1.81873 WP_000887629.1.81881 WP_000887629.1.81914 WP_000887629.1.81934 WP_000887629.1.81935 WP_000887629.1.81939 WP_000887629.1.81952 WP_000887629.1.81972 WP_000887629.1.81975 WP_000887629.1.82 WP_000887629.1.82008 WP_000887629.1.82010 WP_000887629.1.82032 WP_000887629.1.82057 WP_000887629.1.82059 WP_000887629.1.82061 WP_000887629.1.82062 WP_000887629.1.82074 WP_000887629.1.82095 WP_000887629.1.82106 WP_000887629.1.82116 WP_000887629.1.82123 WP_000887629.1.82137 WP_000887629.1.82166 WP_000887629.1.82217 WP_000887629.1.82239 WP_000887629.1.82240 WP_000887629.1.82242 WP_000887629.1.82246 WP_000887629.1.82275 WP_000887629.1.82280 WP_000887629.1.82296 WP_000887629.1.82316 WP_000887629.1.82320 WP_000887629.1.82326 WP_000887629.1.82330 WP_000887629.1.8235 WP_000887629.1.82378 WP_000887629.1.82438 WP_000887629.1.82439 WP_000887629.1.82485 WP_000887629.1.82499 WP_000887629.1.82527 WP_000887629.1.82536 WP_000887629.1.82539 WP_000887629.1.8255 WP_000887629.1.82572 WP_000887629.1.82589 WP_000887629.1.82594 WP_000887629.1.82614 WP_000887629.1.82629 WP_000887629.1.82647 WP_000887629.1.8268 WP_000887629.1.82682 WP_000887629.1.82700 WP_000887629.1.82705 WP_000887629.1.82711 WP_000887629.1.82715 WP_000887629.1.82718 WP_000887629.1.82747 WP_000887629.1.82754 WP_000887629.1.8277 WP_000887629.1.82776 WP_000887629.1.82780 WP_000887629.1.82784 WP_000887629.1.82797 WP_000887629.1.82799 WP_000887629.1.82816 WP_000887629.1.82820 WP_000887629.1.82831 WP_000887629.1.82833 WP_000887629.1.82853 WP_000887629.1.82901 WP_000887629.1.82902 WP_000887629.1.82923 WP_000887629.1.82991 WP_000887629.1.83020 WP_000887629.1.83033 WP_000887629.1.83035 WP_000887629.1.83036 WP_000887629.1.83051 WP_000887629.1.83059 WP_000887629.1.8306 WP_000887629.1.8308 WP_000887629.1.83097 WP_000887629.1.83099 WP_000887629.1.831 WP_000887629.1.83118 WP_000887629.1.83125 WP_000887629.1.83140 WP_000887629.1.83144 WP_000887629.1.83151 WP_000887629.1.83160 WP_000887629.1.83177 WP_000887629.1.83205 WP_000887629.1.83218 WP_000887629.1.83224 WP_000887629.1.83238 WP_000887629.1.83253 WP_000887629.1.83313 WP_000887629.1.83330 WP_000887629.1.83347 WP_000887629.1.83375 WP_000887629.1.83393 WP_000887629.1.83415 WP_000887629.1.8345 WP_000887629.1.83466 WP_000887629.1.83481 WP_000887629.1.83506 WP_000887629.1.83537 WP_000887629.1.83564 WP_000887629.1.83582 WP_000887629.1.83668 WP_000887629.1.83684 WP_000887629.1.83706 WP_000887629.1.83712 WP_000887629.1.83735 WP_000887629.1.83762 WP_000887629.1.83781 WP_000887629.1.83807 WP_000887629.1.83820 WP_000887629.1.8384 WP_000887629.1.8386 WP_000887629.1.83936 WP_000887629.1.83941 WP_000887629.1.83947 WP_000887629.1.84004 WP_000887629.1.84021 WP_000887629.1.84060 WP_000887629.1.84074 WP_000887629.1.8408 WP_000887629.1.8411 WP_000887629.1.84140 WP_000887629.1.84172 WP_000887629.1.84185 WP_000887629.1.84197 WP_000887629.1.84210 WP_000887629.1.84215 WP_000887629.1.84219 WP_000887629.1.84221 WP_000887629.1.84264 WP_000887629.1.84298 WP_000887629.1.84312 WP_000887629.1.84313 WP_000887629.1.84316 WP_000887629.1.84326 WP_000887629.1.84331 WP_000887629.1.84339 WP_000887629.1.84348 WP_000887629.1.84402 WP_000887629.1.84405 WP_000887629.1.84410 WP_000887629.1.84436 WP_000887629.1.8444 WP_000887629.1.84462 WP_000887629.1.84464 WP_000887629.1.84467 WP_000887629.1.8447 WP_000887629.1.84473 WP_000887629.1.84476 WP_000887629.1.84482 WP_000887629.1.84484 WP_000887629.1.84511 WP_000887629.1.84518 WP_000887629.1.84531 WP_000887629.1.84534 WP_000887629.1.84584 WP_000887629.1.84635 WP_000887629.1.84639 WP_000887629.1.84656 WP_000887629.1.84657 WP_000887629.1.84668 WP_000887629.1.84675 WP_000887629.1.84697 WP_000887629.1.8470 WP_000887629.1.84738 WP_000887629.1.84740 WP_000887629.1.84768 WP_000887629.1.8477 WP_000887629.1.84797 WP_000887629.1.84841 WP_000887629.1.84850 WP_000887629.1.84875 WP_000887629.1.84878 WP_000887629.1.84881 WP_000887629.1.84893 WP_000887629.1.84894 WP_000887629.1.84916 WP_000887629.1.84929 WP_000887629.1.84941 WP_000887629.1.84948 WP_000887629.1.84972 WP_000887629.1.84977 WP_000887629.1.84989 WP_000887629.1.85002 WP_000887629.1.85011 WP_000887629.1.85048 WP_000887629.1.85085 WP_000887629.1.85090 WP_000887629.1.85098 WP_000887629.1.85105 WP_000887629.1.85112 WP_000887629.1.85125 WP_000887629.1.85129 WP_000887629.1.85138 WP_000887629.1.85141 WP_000887629.1.85155 WP_000887629.1.85156 WP_000887629.1.85175 WP_000887629.1.85247 WP_000887629.1.85253 WP_000887629.1.85255 WP_000887629.1.85260 WP_000887629.1.8530 WP_000887629.1.85305 WP_000887629.1.85310 WP_000887629.1.85315 WP_000887629.1.85323 WP_000887629.1.85329 WP_000887629.1.85335 WP_000887629.1.85336 WP_000887629.1.85342 WP_000887629.1.85369 WP_000887629.1.85384 WP_000887629.1.85385 WP_000887629.1.85500 WP_000887629.1.85504 WP_000887629.1.85546 WP_000887629.1.85554 WP_000887629.1.85556 WP_000887629.1.85558 WP_000887629.1.85563 WP_000887629.1.8560 WP_000887629.1.85601 WP_000887629.1.85621 WP_000887629.1.85623 WP_000887629.1.85657 WP_000887629.1.85685 WP_000887629.1.85722 WP_000887629.1.85752 WP_000887629.1.85762 WP_000887629.1.85767 WP_000887629.1.85772 WP_000887629.1.85773 WP_000887629.1.8579 WP_000887629.1.85793 WP_000887629.1.85800 WP_000887629.1.85857 WP_000887629.1.85895 WP_000887629.1.8592 WP_000887629.1.85939 WP_000887629.1.85944 WP_000887629.1.85948 WP_000887629.1.86 WP_000887629.1.86001 WP_000887629.1.86016 WP_000887629.1.8603 WP_000887629.1.86035 WP_000887629.1.86063 WP_000887629.1.8607 WP_000887629.1.86105 WP_000887629.1.86115 WP_000887629.1.86145 WP_000887629.1.86149 WP_000887629.1.86161 WP_000887629.1.86166 WP_000887629.1.86171 WP_000887629.1.86181 WP_000887629.1.86189 WP_000887629.1.86196 WP_000887629.1.8621 WP_000887629.1.86210 WP_000887629.1.86227 WP_000887629.1.86228 WP_000887629.1.86234 WP_000887629.1.86255 WP_000887629.1.86261 WP_000887629.1.86263 WP_000887629.1.86266 WP_000887629.1.86280 WP_000887629.1.86283 WP_000887629.1.86307 WP_000887629.1.86340 WP_000887629.1.8635 WP_000887629.1.86355 WP_000887629.1.86364 WP_000887629.1.86371 WP_000887629.1.86376 WP_000887629.1.86393 WP_000887629.1.86411 WP_000887629.1.86412 WP_000887629.1.86451 WP_000887629.1.86452 WP_000887629.1.86454 WP_000887629.1.86461 WP_000887629.1.86475 WP_000887629.1.86518 WP_000887629.1.8652 WP_000887629.1.86574 WP_000887629.1.86583 WP_000887629.1.86586 WP_000887629.1.86598 WP_000887629.1.86609 WP_000887629.1.86617 WP_000887629.1.86627 WP_000887629.1.86640 WP_000887629.1.86667 WP_000887629.1.86673 WP_000887629.1.86674 WP_000887629.1.86691 WP_000887629.1.86707 WP_000887629.1.86727 WP_000887629.1.86731 WP_000887629.1.86734 WP_000887629.1.86753 WP_000887629.1.86760 WP_000887629.1.86787 WP_000887629.1.86833 WP_000887629.1.86846 WP_000887629.1.86848 WP_000887629.1.8687 WP_000887629.1.86935 WP_000887629.1.86959 WP_000887629.1.86975 WP_000887629.1.86994 WP_000887629.1.87043 WP_000887629.1.8705 WP_000887629.1.87059 WP_000887629.1.87067 WP_000887629.1.87074 WP_000887629.1.87075 WP_000887629.1.87076 WP_000887629.1.87102 WP_000887629.1.87109 WP_000887629.1.8711 WP_000887629.1.87177 WP_000887629.1.87189 WP_000887629.1.87199 WP_000887629.1.87205 WP_000887629.1.87247 WP_000887629.1.87249 WP_000887629.1.87254 WP_000887629.1.87310 WP_000887629.1.87339 WP_000887629.1.87358 WP_000887629.1.87371 WP_000887629.1.87389 WP_000887629.1.87400 WP_000887629.1.87410 WP_000887629.1.87443 WP_000887629.1.87465 WP_000887629.1.87504 WP_000887629.1.87557 WP_000887629.1.87563 WP_000887629.1.87568 WP_000887629.1.87574 WP_000887629.1.87581 WP_000887629.1.87590 WP_000887629.1.87607 WP_000887629.1.87608 WP_000887629.1.87610 WP_000887629.1.87616 WP_000887629.1.87639 WP_000887629.1.87655 WP_000887629.1.87675 WP_000887629.1.87694 WP_000887629.1.87696 WP_000887629.1.8771 WP_000887629.1.87721 WP_000887629.1.87726 WP_000887629.1.87728 WP_000887629.1.8778 WP_000887629.1.87788 WP_000887629.1.87789 WP_000887629.1.87822 WP_000887629.1.87834 WP_000887629.1.87857 WP_000887629.1.87914 WP_000887629.1.87919 WP_000887629.1.87973 WP_000887629.1.87976 WP_000887629.1.87980 WP_000887629.1.87984 WP_000887629.1.87989 WP_000887629.1.880 WP_000887629.1.88017 WP_000887629.1.88020 WP_000887629.1.88066 WP_000887629.1.8807 WP_000887629.1.88110 WP_000887629.1.88119 WP_000887629.1.88149 WP_000887629.1.88155 WP_000887629.1.88189 WP_000887629.1.8822 WP_000887629.1.88234 WP_000887629.1.88238 WP_000887629.1.88252 WP_000887629.1.88260 WP_000887629.1.88263 WP_000887629.1.88285 WP_000887629.1.88301 WP_000887629.1.88304 WP_000887629.1.88336 WP_000887629.1.88352 WP_000887629.1.88376 WP_000887629.1.88379 WP_000887629.1.88384 WP_000887629.1.88427 WP_000887629.1.8843 WP_000887629.1.88434 WP_000887629.1.88438 WP_000887629.1.88462 WP_000887629.1.88499 WP_000887629.1.88524 WP_000887629.1.88527 WP_000887629.1.88528 WP_000887629.1.88535 WP_000887629.1.88539 WP_000887629.1.8854 WP_000887629.1.8855 WP_000887629.1.88557 WP_000887629.1.88562 WP_000887629.1.88577 WP_000887629.1.88598 WP_000887629.1.88603 WP_000887629.1.88607 WP_000887629.1.88631 WP_000887629.1.88646 WP_000887629.1.88678 WP_000887629.1.88685 WP_000887629.1.88709 WP_000887629.1.88710 WP_000887629.1.88711 WP_000887629.1.88720 WP_000887629.1.88729 WP_000887629.1.88732 WP_000887629.1.88752 WP_000887629.1.88757 WP_000887629.1.88759 WP_000887629.1.8879 WP_000887629.1.88834 WP_000887629.1.88864 WP_000887629.1.88880 WP_000887629.1.88883 WP_000887629.1.88891 WP_000887629.1.88941 WP_000887629.1.88950 WP_000887629.1.88961 WP_000887629.1.88997 WP_000887629.1.89050 WP_000887629.1.8906 WP_000887629.1.89067 WP_000887629.1.89069 WP_000887629.1.89090 WP_000887629.1.89099 WP_000887629.1.89111 WP_000887629.1.89183 WP_000887629.1.89197 WP_000887629.1.89200 WP_000887629.1.89203 WP_000887629.1.89255 WP_000887629.1.8928 WP_000887629.1.89305 WP_000887629.1.89312 WP_000887629.1.89322 WP_000887629.1.89334 WP_000887629.1.89335 WP_000887629.1.89351 WP_000887629.1.8938 WP_000887629.1.89385 WP_000887629.1.894 WP_000887629.1.89400 WP_000887629.1.89403 WP_000887629.1.89405 WP_000887629.1.89416 WP_000887629.1.89427 WP_000887629.1.89432 WP_000887629.1.8945 WP_000887629.1.89455 WP_000887629.1.89458 WP_000887629.1.89468 WP_000887629.1.89474 WP_000887629.1.89479 WP_000887629.1.89492 WP_000887629.1.89510 WP_000887629.1.89551 WP_000887629.1.89569 WP_000887629.1.89601 WP_000887629.1.89605 WP_000887629.1.89627 WP_000887629.1.89630 WP_000887629.1.89631 WP_000887629.1.89646 WP_000887629.1.89656 WP_000887629.1.89674 WP_000887629.1.89679 WP_000887629.1.89700 WP_000887629.1.89710 WP_000887629.1.89747 WP_000887629.1.89768 WP_000887629.1.89781 WP_000887629.1.89788 WP_000887629.1.89818 WP_000887629.1.89839 WP_000887629.1.89841 WP_000887629.1.8985 WP_000887629.1.89852 WP_000887629.1.89859 WP_000887629.1.89879 WP_000887629.1.89895 WP_000887629.1.89915 WP_000887629.1.89917 WP_000887629.1.89918 WP_000887629.1.89920 WP_000887629.1.89923 WP_000887629.1.89925 WP_000887629.1.89927 WP_000887629.1.89959 WP_000887629.1.89977 WP_000887629.1.89988 WP_000887629.1.90017 WP_000887629.1.90050 WP_000887629.1.90063 WP_000887629.1.90078 WP_000887629.1.9009 WP_000887629.1.9010 WP_000887629.1.90115 WP_000887629.1.90128 WP_000887629.1.90139 WP_000887629.1.90146 WP_000887629.1.90156 WP_000887629.1.90168 WP_000887629.1.90171 WP_000887629.1.90182 WP_000887629.1.90205 WP_000887629.1.90219 WP_000887629.1.90249 WP_000887629.1.90256 WP_000887629.1.90257 WP_000887629.1.90266 WP_000887629.1.90270 WP_000887629.1.90332 WP_000887629.1.90342 WP_000887629.1.90346 WP_000887629.1.90349 WP_000887629.1.90358 WP_000887629.1.9036 WP_000887629.1.90389 WP_000887629.1.90405 WP_000887629.1.90435 WP_000887629.1.90436 WP_000887629.1.90441 WP_000887629.1.90449 WP_000887629.1.90467 WP_000887629.1.90511 WP_000887629.1.90520 WP_000887629.1.90525 WP_000887629.1.90536 WP_000887629.1.90542 WP_000887629.1.90547 WP_000887629.1.9059 WP_000887629.1.90591 WP_000887629.1.90602 WP_000887629.1.9061 WP_000887629.1.90626 WP_000887629.1.90690 WP_000887629.1.90703 WP_000887629.1.90706 WP_000887629.1.90758 WP_000887629.1.90799 WP_000887629.1.90813 WP_000887629.1.90822 WP_000887629.1.90828 WP_000887629.1.90834 WP_000887629.1.90837 WP_000887629.1.90839 WP_000887629.1.9084 WP_000887629.1.90844 WP_000887629.1.90848 WP_000887629.1.90856 WP_000887629.1.90864 WP_000887629.1.90865 WP_000887629.1.90873 WP_000887629.1.90890 WP_000887629.1.909 WP_000887629.1.90951 WP_000887629.1.90979 WP_000887629.1.9098 WP_000887629.1.90988 WP_000887629.1.90997 WP_000887629.1.91018 WP_000887629.1.91072 WP_000887629.1.91088 WP_000887629.1.91094 WP_000887629.1.91113 WP_000887629.1.91117 WP_000887629.1.91138 WP_000887629.1.91143 WP_000887629.1.91153 WP_000887629.1.91170 WP_000887629.1.9118 WP_000887629.1.9119 WP_000887629.1.91220 WP_000887629.1.91266 WP_000887629.1.91268 WP_000887629.1.91288 WP_000887629.1.91290 WP_000887629.1.91340 WP_000887629.1.91341 WP_000887629.1.91354 WP_000887629.1.91356 WP_000887629.1.91384 WP_000887629.1.91397 WP_000887629.1.91414 WP_000887629.1.91445 WP_000887629.1.91462 WP_000887629.1.91482 WP_000887629.1.91485 WP_000887629.1.915 WP_000887629.1.91511 WP_000887629.1.91515 WP_000887629.1.91516 WP_000887629.1.91526 WP_000887629.1.91548 WP_000887629.1.91551 WP_000887629.1.91565 WP_000887629.1.9157 WP_000887629.1.91594 WP_000887629.1.91596 WP_000887629.1.9160 WP_000887629.1.91626 WP_000887629.1.91630 WP_000887629.1.91640 WP_000887629.1.91643 WP_000887629.1.91651 WP_000887629.1.91666 WP_000887629.1.9168 WP_000887629.1.91685 WP_000887629.1.9169 WP_000887629.1.91701 WP_000887629.1.9171 WP_000887629.1.91739 WP_000887629.1.91777 WP_000887629.1.91779 WP_000887629.1.91782 WP_000887629.1.91787 WP_000887629.1.91793 WP_000887629.1.91801 WP_000887629.1.91814 WP_000887629.1.91843 WP_000887629.1.9185 WP_000887629.1.91850 WP_000887629.1.91863 WP_000887629.1.91871 WP_000887629.1.91879 WP_000887629.1.91893 WP_000887629.1.91951 WP_000887629.1.91959 WP_000887629.1.91965 WP_000887629.1.91971 WP_000887629.1.9199 WP_000887629.1.91994 WP_000887629.1.92005 WP_000887629.1.92014 WP_000887629.1.92019 WP_000887629.1.92025 WP_000887629.1.92029 WP_000887629.1.92048 WP_000887629.1.92053 WP_000887629.1.92058 WP_000887629.1.921 WP_000887629.1.92102 WP_000887629.1.92114 WP_000887629.1.9215 WP_000887629.1.92161 WP_000887629.1.92163 WP_000887629.1.92180 WP_000887629.1.92195 WP_000887629.1.92201 WP_000887629.1.92224 WP_000887629.1.92276 WP_000887629.1.92305 WP_000887629.1.92311 WP_000887629.1.92361 WP_000887629.1.92384 WP_000887629.1.924 WP_000887629.1.92403 WP_000887629.1.92434 WP_000887629.1.92462 WP_000887629.1.92495 WP_000887629.1.92496 WP_000887629.1.92506 WP_000887629.1.92532 WP_000887629.1.92535 WP_000887629.1.9255 WP_000887629.1.92568 WP_000887629.1.92571 WP_000887629.1.92577 WP_000887629.1.92614 WP_000887629.1.92615 WP_000887629.1.92638 WP_000887629.1.9264 WP_000887629.1.9266 WP_000887629.1.92668 WP_000887629.1.92708 WP_000887629.1.92719 WP_000887629.1.92742 WP_000887629.1.92750 WP_000887629.1.92780 WP_000887629.1.92781 WP_000887629.1.92792 WP_000887629.1.92793 WP_000887629.1.92796 WP_000887629.1.92819 WP_000887629.1.92845 WP_000887629.1.92865 WP_000887629.1.92932 WP_000887629.1.92953 WP_000887629.1.92991 WP_000887629.1.93005 WP_000887629.1.93016 WP_000887629.1.93017 WP_000887629.1.93019 WP_000887629.1.93027 WP_000887629.1.93048 WP_000887629.1.93054 WP_000887629.1.93069 WP_000887629.1.93072 WP_000887629.1.93085 WP_000887629.1.93100 WP_000887629.1.93112 WP_000887629.1.93133 WP_000887629.1.93138 WP_000887629.1.93175 WP_000887629.1.93252 WP_000887629.1.93267 WP_000887629.1.9327 WP_000887629.1.93276 WP_000887629.1.93291 WP_000887629.1.93309 WP_000887629.1.93312 WP_000887629.1.93326 WP_000887629.1.93338 WP_000887629.1.93379 WP_000887629.1.93388 WP_000887629.1.93427 WP_000887629.1.93428 WP_000887629.1.93431 WP_000887629.1.93463 WP_000887629.1.93464 WP_000887629.1.93468 WP_000887629.1.93509 WP_000887629.1.93531 WP_000887629.1.93533 WP_000887629.1.93552 WP_000887629.1.93569 WP_000887629.1.93601 WP_000887629.1.93626 WP_000887629.1.93629 WP_000887629.1.93630 WP_000887629.1.93634 WP_000887629.1.93637 WP_000887629.1.93639 WP_000887629.1.93652 WP_000887629.1.93665 WP_000887629.1.93670 WP_000887629.1.93673 WP_000887629.1.93679 WP_000887629.1.93694 WP_000887629.1.93695 WP_000887629.1.93733 WP_000887629.1.93742 WP_000887629.1.93743 WP_000887629.1.93755 WP_000887629.1.938 WP_000887629.1.93800 WP_000887629.1.93821 WP_000887629.1.93870 WP_000887629.1.93873 WP_000887629.1.93877 WP_000887629.1.939 WP_000887629.1.93900 WP_000887629.1.93911 WP_000887629.1.93918 WP_000887629.1.93921 WP_000887629.1.93922 WP_000887629.1.93951 WP_000887629.1.93971 WP_000887629.1.94008 WP_000887629.1.94011 WP_000887629.1.94025 WP_000887629.1.94028 WP_000887629.1.94035 WP_000887629.1.94057 WP_000887629.1.94069 WP_000887629.1.94156 WP_000887629.1.9416 WP_000887629.1.94176 WP_000887629.1.94187 WP_000887629.1.9420 WP_000887629.1.94213 WP_000887629.1.94232 WP_000887629.1.9426 WP_000887629.1.94271 WP_000887629.1.94298 WP_000887629.1.94302 WP_000887629.1.94317 WP_000887629.1.94343 WP_000887629.1.94353 WP_000887629.1.94388 WP_000887629.1.94404 WP_000887629.1.94417 WP_000887629.1.94429 WP_000887629.1.94438 WP_000887629.1.94445 WP_000887629.1.94446 WP_000887629.1.94468 WP_000887629.1.94475 WP_000887629.1.94497 WP_000887629.1.94507 WP_000887629.1.94516 WP_000887629.1.94523 WP_000887629.1.94542 WP_000887629.1.94544 WP_000887629.1.94548 WP_000887629.1.9457 WP_000887629.1.94578 WP_000887629.1.94580 WP_000887629.1.94589 WP_000887629.1.94646 WP_000887629.1.94676 WP_000887629.1.94690 WP_000887629.1.94692 WP_000887629.1.94704 WP_000887629.1.94738 WP_000887629.1.94739 WP_000887629.1.94753 WP_000887629.1.94754 WP_000887629.1.94764 WP_000887629.1.94787 WP_000887629.1.94790 WP_000887629.1.948 WP_000887629.1.94801 WP_000887629.1.94806 WP_000887629.1.94808 WP_000887629.1.94822 WP_000887629.1.94877 WP_000887629.1.94880 WP_000887629.1.94889 WP_000887629.1.9489 WP_000887629.1.94892 WP_000887629.1.94898 WP_000887629.1.949 WP_000887629.1.94903 WP_000887629.1.9491 WP_000887629.1.94938 WP_000887629.1.94949 WP_000887629.1.94955 WP_000887629.1.94963 WP_000887629.1.94991 WP_000887629.1.94993 WP_000887629.1.94997 WP_000887629.1.95005 WP_000887629.1.95011 WP_000887629.1.95022 WP_000887629.1.95028 WP_000887629.1.95035 WP_000887629.1.95036 WP_000887629.1.95037 WP_000887629.1.95062 WP_000887629.1.95105 WP_000887629.1.95129 WP_000887629.1.9513 WP_000887629.1.95161 WP_000887629.1.95198 WP_000887629.1.95233 WP_000887629.1.95243 WP_000887629.1.95244 WP_000887629.1.95275 WP_000887629.1.95310 WP_000887629.1.95329 WP_000887629.1.95332 WP_000887629.1.95364 WP_000887629.1.95366 WP_000887629.1.95368 WP_000887629.1.95378 WP_000887629.1.95381 WP_000887629.1.95390 WP_000887629.1.95395 WP_000887629.1.95400 WP_000887629.1.95403 WP_000887629.1.95424 WP_000887629.1.95428 WP_000887629.1.95431 WP_000887629.1.95438 WP_000887629.1.95449 WP_000887629.1.95490 WP_000887629.1.95521 WP_000887629.1.95563 WP_000887629.1.9559 WP_000887629.1.95595 WP_000887629.1.95596 WP_000887629.1.95604 WP_000887629.1.95611 WP_000887629.1.95634 WP_000887629.1.95655 WP_000887629.1.9566 WP_000887629.1.95666 WP_000887629.1.95756 WP_000887629.1.95759 WP_000887629.1.95771 WP_000887629.1.95783 WP_000887629.1.95800 WP_000887629.1.95801 WP_000887629.1.95821 WP_000887629.1.95824 WP_000887629.1.95827 WP_000887629.1.95834 WP_000887629.1.95835 WP_000887629.1.95849 WP_000887629.1.95858 WP_000887629.1.95865 WP_000887629.1.95869 WP_000887629.1.95916 WP_000887629.1.95919 WP_000887629.1.95929 WP_000887629.1.95932 WP_000887629.1.960 WP_000887629.1.96015 WP_000887629.1.96032 WP_000887629.1.96053 WP_000887629.1.96059 WP_000887629.1.96066 WP_000887629.1.96086 WP_000887629.1.96097 WP_000887629.1.96114 WP_000887629.1.96143 WP_000887629.1.96145 WP_000887629.1.9616 WP_000887629.1.96177 WP_000887629.1.96215 WP_000887629.1.96222 WP_000887629.1.96223 WP_000887629.1.96247 WP_000887629.1.96253 WP_000887629.1.96281 WP_000887629.1.96290 WP_000887629.1.96293 WP_000887629.1.96299 WP_000887629.1.96303 WP_000887629.1.96339 WP_000887629.1.96341 WP_000887629.1.96394 WP_000887629.1.96417 WP_000887629.1.96420 WP_000887629.1.96425 WP_000887629.1.96450 WP_000887629.1.96457 WP_000887629.1.96478 WP_000887629.1.96479 WP_000887629.1.96480 WP_000887629.1.96484 WP_000887629.1.96494 WP_000887629.1.965 WP_000887629.1.96562 WP_000887629.1.9657 WP_000887629.1.96585 WP_000887629.1.96609 WP_000887629.1.9661 WP_000887629.1.96633 WP_000887629.1.96659 WP_000887629.1.96676 WP_000887629.1.9668 WP_000887629.1.96683 WP_000887629.1.96695 WP_000887629.1.96701 WP_000887629.1.9671 WP_000887629.1.96743 WP_000887629.1.96753 WP_000887629.1.96759 WP_000887629.1.96779 WP_000887629.1.96796 WP_000887629.1.96797 WP_000887629.1.96817 WP_000887629.1.96864 WP_000887629.1.9690 WP_000887629.1.96907 WP_000887629.1.9691 WP_000887629.1.96924 WP_000887629.1.96936 WP_000887629.1.96944 WP_000887629.1.96984 WP_000887629.1.96989 WP_000887629.1.97011 WP_000887629.1.97027 WP_000887629.1.97049 WP_000887629.1.97059 WP_000887629.1.9708 WP_000887629.1.97119 WP_000887629.1.97123 WP_000887629.1.97147 WP_000887629.1.97170 WP_000887629.1.97193 WP_000887629.1.97195 WP_000887629.1.97200 WP_000887629.1.97226 WP_000887629.1.97231 WP_000887629.1.97238 WP_000887629.1.97248 WP_000887629.1.97282 WP_000887629.1.9729 WP_000887629.1.97344 WP_000887629.1.97351 WP_000887629.1.97356 WP_000887629.1.97360 WP_000887629.1.97361 WP_000887629.1.97379 WP_000887629.1.97387 WP_000887629.1.9740 WP_000887629.1.97402 WP_000887629.1.97418 WP_000887629.1.97421 WP_000887629.1.97434 WP_000887629.1.97439 WP_000887629.1.97459 WP_000887629.1.9747 WP_000887629.1.97513 WP_000887629.1.97525 WP_000887629.1.97527 WP_000887629.1.97538 WP_000887629.1.97544 WP_000887629.1.97549 WP_000887629.1.97560 WP_000887629.1.97571 WP_000887629.1.97619 WP_000887629.1.97632 WP_000887629.1.97654 WP_000887629.1.97667 WP_000887629.1.97675 WP_000887629.1.97677 WP_000887629.1.97685 WP_000887629.1.9770 WP_000887629.1.97705 WP_000887629.1.97711 WP_000887629.1.97775 WP_000887629.1.97778 WP_000887629.1.978 WP_000887629.1.97802 WP_000887629.1.97822 WP_000887629.1.97823 WP_000887629.1.97825 WP_000887629.1.97871 WP_000887629.1.97895 WP_000887629.1.97930 WP_000887629.1.97962 WP_000887629.1.97982 WP_000887629.1.97996 WP_000887629.1.98000 WP_000887629.1.98005 WP_000887629.1.98012 WP_000887629.1.98026 WP_000887629.1.9803 WP_000887629.1.98046 WP_000887629.1.98082 WP_000887629.1.98083 WP_000887629.1.981 WP_000887629.1.98102 WP_000887629.1.98115 WP_000887629.1.98139 WP_000887629.1.98155 WP_000887629.1.9816 WP_000887629.1.9817 WP_000887629.1.98176 WP_000887629.1.98187 WP_000887629.1.98202 WP_000887629.1.98205 WP_000887629.1.98220 WP_000887629.1.98232 WP_000887629.1.98235 WP_000887629.1.98239 WP_000887629.1.98241 WP_000887629.1.98251 WP_000887629.1.98279 WP_000887629.1.98284 WP_000887629.1.98292 WP_000887629.1.98294 WP_000887629.1.98301 WP_000887629.1.98312 WP_000887629.1.98355 WP_000887629.1.98357 WP_000887629.1.98384 WP_000887629.1.98400 WP_000887629.1.98404 WP_000887629.1.98429 WP_000887629.1.9844 WP_000887629.1.98442 WP_000887629.1.98451 WP_000887629.1.98477 WP_000887629.1.98498 WP_000887629.1.98543 WP_000887629.1.98549 WP_000887629.1.98569 WP_000887629.1.9858 WP_000887629.1.98603 WP_000887629.1.98614 WP_000887629.1.98633 WP_000887629.1.9864 WP_000887629.1.98641 WP_000887629.1.98654 WP_000887629.1.98665 WP_000887629.1.98668 WP_000887629.1.98702 WP_000887629.1.98727 WP_000887629.1.98775 WP_000887629.1.98776 WP_000887629.1.98795 WP_000887629.1.9883 WP_000887629.1.98849 WP_000887629.1.98875 WP_000887629.1.98886 WP_000887629.1.98908 WP_000887629.1.98920 WP_000887629.1.98976 WP_000887629.1.99006 WP_000887629.1.99029 WP_000887629.1.99046 WP_000887629.1.99053 WP_000887629.1.9907 WP_000887629.1.99101 WP_000887629.1.99110 WP_000887629.1.99168 WP_000887629.1.99182 WP_000887629.1.99209 WP_000887629.1.99234 WP_000887629.1.99246 WP_000887629.1.99265 WP_000887629.1.99289 WP_000887629.1.99292 WP_000887629.1.99295 WP_000887629.1.9930 WP_000887629.1.99302 WP_000887629.1.99304 WP_000887629.1.99307 WP_000887629.1.99310 WP_000887629.1.99319 WP_000887629.1.99334 WP_000887629.1.99345 WP_000887629.1.9935 WP_000887629.1.99361 WP_000887629.1.99392 WP_000887629.1.9940 WP_000887629.1.99400 WP_000887629.1.99401 WP_000887629.1.99427 WP_000887629.1.99446 WP_000887629.1.99453 WP_000887629.1.99458 WP_000887629.1.99471 WP_000887629.1.99475 WP_000887629.1.99486 WP_000887629.1.99487 WP_000887629.1.99498 WP_000887629.1.9950 WP_000887629.1.99501 WP_000887629.1.99511 WP_000887629.1.99534 WP_000887629.1.99549 WP_000887629.1.99562 WP_000887629.1.99592 WP_000887629.1.99602 WP_000887629.1.99603 WP_000887629.1.99619 WP_000887629.1.99632 WP_000887629.1.99641 WP_000887629.1.99666 WP_000887629.1.99692 WP_000887629.1.99734 WP_000887629.1.99771 WP_000887629.1.99774 WP_000887629.1.99791 WP_000887629.1.99804 WP_000887629.1.99827 WP_000887629.1.99869 WP_000887629.1.99874 WP_000887629.1.99892 WP_000887629.1.99912 WP_000887629.1.99929 WP_000887629.1.99986 YP_002406610.1.10275 YP_006118917.1.29421 YP_006780383.1.12065 gi|383177176|ref|YP_005455181.1| gi|386708391|ref|YP_006172112.1| gi|251784110|ref|YP_002998414.1| gi|218557547|ref|YP_002390460.1| gi|471332687|ref|YP_007556164.1| gi|254160688|ref|YP_003043796.1| gi|260853860|ref|YP_003227751.1| gi|407483234|ref|YP_006780383.1| gi|251784110|ref|YP_002998414.1| gi|443616644|ref|YP_007380500.1| gi|387620351|ref|YP_006127978.1| gi|254791774|ref|YP_003076611.1| gi|218698981|ref|YP_002406610.1| gi|386708391|ref|YP_006172112.1| gi|387615895|ref|YP_006118917.1| gi|90111152|ref|NP_415139.2| gi|260866756|ref|YP_003233158.1| gi|407468035|ref|YP_006785523.1| 316385.ECDH10B_0567 316385.ECDH10B_0675 316407.ahpF 413997.ECB_00575 511145.b0606 544404.ECSP_0661 573235.ECO26_0682 585034.ECIAI1_0591 585035.ECS88_0648 585055.EC55989_0599 585057.ECIAI39_0584 585395.ECO103_0615 585396.ECO111_0638 595496.BWG_0480 gi|238899886|ref|YP_002925682.1| gi|387611110|ref|YP_006114226.1| gi|222155364|ref|YP_002555503.1| gi|218553150|ref|YP_002386063.1| gi|386703792|ref|YP_006167639.1| gi|386605469|ref|YP_006111769.1| gi|260842835|ref|YP_003220613.1| gi|544389401|ref|YP_008563797.1| gi|170080188|ref|YP_001729508.1| gi|170080289|ref|YP_001729609.1| gi|410483787|ref|YP_006771333.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]