SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|218553474|ref|YP_002386387.1| from Escherichia coli IAI1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|218553474|ref|YP_002386387.1|
Domain Number 1 Region: 2-315
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.39e-53
Family FAD/NAD-linked reductases, N-terminal and central domains 0.000000772
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|218553474|ref|YP_002386387.1|
Sequence length 321
Comment thioredoxin reductase [Escherichia coli IAI1]
Sequence
MGTTKHSKLLILGSGPAGYTAAVYAARANLQPVLITGMEKGGQLTTTTEVENWPGDPNDL
TGPLLMERMHEHATKFETEIIFDHINKVDLQNRPFRLNGDNGEYTCDALIIATGASARYL
GLPSEEAFKGRGVSACATCDGFFYRNQKVAVIGGGNTAVEEALYLSNIASEVHLIHRRDG
FRAEKILIKRLMDKVENGNIILHTNRTLEEVTGDQMGVTGVRLRDTQNSDNIESLDVAGL
FVAIGHSPNTAIFEGQLELENGYIKVQSGIHGNATQTSIPGVFAAGDVMDHIYRQAITSA
GTGCMAALDAERYLDGLADAK
Download sequence
Identical sequences A0A024KQY1 A0A026UIA8 A0A027U701 A0A064TRU9 A0A070F2N8 A0A070SKQ2 A0A070V1C1 A0A073G0L8 A0A074I4W3 A0A080G559 A0A0A0F8Q1 A0A0A8U5C4 A0A0E0TWW9 A0A0E0Y1T0 A0A0E1T3E5 A0A0F6C188 A0A0F6F3E7 A0A0H3PT32 A0A0H7L1A6 A0A0M7PBN6 A0A140NDA6 A0A142H1B2 A0A1Q8MAL7 A0A1S6T9A7 A0A1S9K896 A0A1X3I8W9 A0A1X3IQW2 A0A1X3JJR6 A0A1X3L4N4 A0A1X3LH98 A0A1Z3USK7 A0A222QID5 A0A2A2XH71 A0A2H1BES7 A7ZJV6 B6I8V9 B7LD80 C3TGL2 C8U4G8 C8ULB1 D3QP87 D6HUT9 D7XJB8 D8EAE8 E0IZF4 E1IQS3 E1JAH7 E2X3P0 E6BCP5 E7SJB9 E7TIW5 E9TEU0 F4SLZ7 F4TCB3 F4VCR1 G0F504 I0VPI2 I2S5U7 I2SYL0 I2UM22 I2WD89 I2WLJ3 I2XDY9 I6D1A4 I6E0Q0 I6FRU4 J7RPR1 K4V2J2 L2V915 L3QQJ4 M9GAS1 P0A9P4 P0A9P5 Q323L5 Q32E07 Q3Z3N2 S1ERU7 S1IQK2 S1J2W7 T6A3I7 T9D846 U9Y2P6 V0A9H3 V2SN53 V8FEX0 V8KTU4 W1BH53 W1F553
gi|378713709|ref|YP_005278602.1| gi|260867060|ref|YP_003233462.1| gi|388476972|ref|YP_489160.1| gi|254161002|ref|YP_003044110.1| gi|387506001|ref|YP_006158257.1| gi|218694361|ref|YP_002402028.1| gi|443616961|ref|YP_007380817.1| gi|238900146|ref|YP_002925942.1| gi|251784430|ref|YP_002998734.1| gi|407482907|ref|YP_006780056.1| gi|386708699|ref|YP_006172420.1| gi|544389650|ref|YP_008564057.1| gi|15800751|ref|NP_286765.1| gi|291281891|ref|YP_003498709.1| gi|387620613|ref|YP_006128240.1| NP_309000.1.58667 NP_415408.1.90541 WP_000537418.1.10001 WP_000537418.1.100044 WP_000537418.1.100063 WP_000537418.1.100066 WP_000537418.1.100073 WP_000537418.1.100085 WP_000537418.1.10010 WP_000537418.1.100111 WP_000537418.1.100116 WP_000537418.1.100135 WP_000537418.1.100138 WP_000537418.1.100159 WP_000537418.1.100185 WP_000537418.1.100251 WP_000537418.1.100252 WP_000537418.1.100283 WP_000537418.1.100299 WP_000537418.1.100302 WP_000537418.1.100315 WP_000537418.1.10034 WP_000537418.1.100389 WP_000537418.1.100425 WP_000537418.1.100441 WP_000537418.1.100444 WP_000537418.1.100447 WP_000537418.1.100448 WP_000537418.1.100451 WP_000537418.1.10048 WP_000537418.1.100487 WP_000537418.1.100496 WP_000537418.1.100499 WP_000537418.1.100508 WP_000537418.1.10051 WP_000537418.1.100543 WP_000537418.1.100554 WP_000537418.1.100571 WP_000537418.1.100573 WP_000537418.1.100614 WP_000537418.1.100667 WP_000537418.1.10067 WP_000537418.1.10068 WP_000537418.1.100689 WP_000537418.1.100718 WP_000537418.1.100725 WP_000537418.1.100752 WP_000537418.1.100753 WP_000537418.1.100778 WP_000537418.1.100796 WP_000537418.1.10080 WP_000537418.1.100824 WP_000537418.1.100836 WP_000537418.1.100851 WP_000537418.1.100852 WP_000537418.1.10086 WP_000537418.1.100868 WP_000537418.1.100925 WP_000537418.1.100928 WP_000537418.1.100933 WP_000537418.1.10094 WP_000537418.1.100966 WP_000537418.1.100990 WP_000537418.1.101033 WP_000537418.1.101102 WP_000537418.1.101105 WP_000537418.1.101121 WP_000537418.1.101158 WP_000537418.1.101166 WP_000537418.1.101175 WP_000537418.1.101186 WP_000537418.1.101206 WP_000537418.1.101214 WP_000537418.1.101255 WP_000537418.1.101257 WP_000537418.1.10126 WP_000537418.1.101282 WP_000537418.1.101289 WP_000537418.1.101313 WP_000537418.1.101359 WP_000537418.1.101418 WP_000537418.1.101423 WP_000537418.1.101430 WP_000537418.1.101436 WP_000537418.1.101468 WP_000537418.1.101486 WP_000537418.1.10154 WP_000537418.1.101583 WP_000537418.1.101594 WP_000537418.1.101628 WP_000537418.1.101630 WP_000537418.1.101654 WP_000537418.1.101686 WP_000537418.1.10173 WP_000537418.1.101737 WP_000537418.1.101747 WP_000537418.1.101777 WP_000537418.1.101786 WP_000537418.1.101822 WP_000537418.1.10184 WP_000537418.1.101845 WP_000537418.1.101865 WP_000537418.1.10187 WP_000537418.1.10188 WP_000537418.1.101887 WP_000537418.1.101889 WP_000537418.1.10190 WP_000537418.1.101900 WP_000537418.1.101908 WP_000537418.1.101937 WP_000537418.1.101940 WP_000537418.1.101942 WP_000537418.1.101947 WP_000537418.1.101948 WP_000537418.1.101952 WP_000537418.1.102021 WP_000537418.1.10206 WP_000537418.1.102093 WP_000537418.1.102094 WP_000537418.1.102122 WP_000537418.1.102139 WP_000537418.1.10222 WP_000537418.1.10233 WP_000537418.1.10235 WP_000537418.1.10252 WP_000537418.1.10273 WP_000537418.1.10304 WP_000537418.1.10329 WP_000537418.1.10335 WP_000537418.1.10348 WP_000537418.1.10352 WP_000537418.1.10379 WP_000537418.1.1040 WP_000537418.1.10400 WP_000537418.1.10417 WP_000537418.1.10476 WP_000537418.1.10491 WP_000537418.1.10496 WP_000537418.1.10508 WP_000537418.1.10525 WP_000537418.1.10576 WP_000537418.1.1058 WP_000537418.1.10628 WP_000537418.1.10651 WP_000537418.1.10673 WP_000537418.1.10705 WP_000537418.1.1071 WP_000537418.1.10715 WP_000537418.1.10729 WP_000537418.1.1073 WP_000537418.1.1074 WP_000537418.1.10761 WP_000537418.1.10771 WP_000537418.1.10798 WP_000537418.1.10833 WP_000537418.1.10862 WP_000537418.1.10922 WP_000537418.1.10940 WP_000537418.1.10970 WP_000537418.1.10988 WP_000537418.1.10989 WP_000537418.1.10995 WP_000537418.1.11006 WP_000537418.1.11032 WP_000537418.1.11047 WP_000537418.1.11068 WP_000537418.1.11071 WP_000537418.1.11091 WP_000537418.1.1111 WP_000537418.1.11118 WP_000537418.1.11121 WP_000537418.1.1113 WP_000537418.1.11133 WP_000537418.1.112 WP_000537418.1.1122 WP_000537418.1.11240 WP_000537418.1.11241 WP_000537418.1.11251 WP_000537418.1.11272 WP_000537418.1.11296 WP_000537418.1.11301 WP_000537418.1.11323 WP_000537418.1.11408 WP_000537418.1.11418 WP_000537418.1.11420 WP_000537418.1.11436 WP_000537418.1.11440 WP_000537418.1.11452 WP_000537418.1.11499 WP_000537418.1.11524 WP_000537418.1.11578 WP_000537418.1.11595 WP_000537418.1.11616 WP_000537418.1.11645 WP_000537418.1.11671 WP_000537418.1.11673 WP_000537418.1.1168 WP_000537418.1.11690 WP_000537418.1.11699 WP_000537418.1.11748 WP_000537418.1.1176 WP_000537418.1.11762 WP_000537418.1.11801 WP_000537418.1.11844 WP_000537418.1.1186 WP_000537418.1.11955 WP_000537418.1.11982 WP_000537418.1.12000 WP_000537418.1.12030 WP_000537418.1.12060 WP_000537418.1.12095 WP_000537418.1.12112 WP_000537418.1.1212 WP_000537418.1.1218 WP_000537418.1.12204 WP_000537418.1.12259 WP_000537418.1.12279 WP_000537418.1.12292 WP_000537418.1.12305 WP_000537418.1.12320 WP_000537418.1.12342 WP_000537418.1.12344 WP_000537418.1.12352 WP_000537418.1.12415 WP_000537418.1.1242 WP_000537418.1.12426 WP_000537418.1.12458 WP_000537418.1.12478 WP_000537418.1.12542 WP_000537418.1.12552 WP_000537418.1.12558 WP_000537418.1.12566 WP_000537418.1.12582 WP_000537418.1.12623 WP_000537418.1.12646 WP_000537418.1.12675 WP_000537418.1.12680 WP_000537418.1.12693 WP_000537418.1.127 WP_000537418.1.12717 WP_000537418.1.12743 WP_000537418.1.1275 WP_000537418.1.12756 WP_000537418.1.12775 WP_000537418.1.12781 WP_000537418.1.1280 WP_000537418.1.12831 WP_000537418.1.12876 WP_000537418.1.12893 WP_000537418.1.12911 WP_000537418.1.12914 WP_000537418.1.1295 WP_000537418.1.12979 WP_000537418.1.12987 WP_000537418.1.13002 WP_000537418.1.13015 WP_000537418.1.13031 WP_000537418.1.13060 WP_000537418.1.13074 WP_000537418.1.1312 WP_000537418.1.13136 WP_000537418.1.13144 WP_000537418.1.1315 WP_000537418.1.13162 WP_000537418.1.13176 WP_000537418.1.13217 WP_000537418.1.13223 WP_000537418.1.13239 WP_000537418.1.13252 WP_000537418.1.13258 WP_000537418.1.13278 WP_000537418.1.13290 WP_000537418.1.13301 WP_000537418.1.13332 WP_000537418.1.13333 WP_000537418.1.13346 WP_000537418.1.13348 WP_000537418.1.1335 WP_000537418.1.13383 WP_000537418.1.13411 WP_000537418.1.13430 WP_000537418.1.13437 WP_000537418.1.13442 WP_000537418.1.1345 WP_000537418.1.13481 WP_000537418.1.13495 WP_000537418.1.13525 WP_000537418.1.13566 WP_000537418.1.13585 WP_000537418.1.13589 WP_000537418.1.13601 WP_000537418.1.13618 WP_000537418.1.13624 WP_000537418.1.13656 WP_000537418.1.13664 WP_000537418.1.13672 WP_000537418.1.13740 WP_000537418.1.13791 WP_000537418.1.13798 WP_000537418.1.13824 WP_000537418.1.13867 WP_000537418.1.13877 WP_000537418.1.13881 WP_000537418.1.13891 WP_000537418.1.13924 WP_000537418.1.13936 WP_000537418.1.13939 WP_000537418.1.13944 WP_000537418.1.13949 WP_000537418.1.13974 WP_000537418.1.13981 WP_000537418.1.14030 WP_000537418.1.14062 WP_000537418.1.14070 WP_000537418.1.14094 WP_000537418.1.14110 WP_000537418.1.14127 WP_000537418.1.14154 WP_000537418.1.1419 WP_000537418.1.14199 WP_000537418.1.142 WP_000537418.1.14253 WP_000537418.1.14277 WP_000537418.1.14292 WP_000537418.1.14299 WP_000537418.1.14346 WP_000537418.1.1438 WP_000537418.1.1439 WP_000537418.1.14398 WP_000537418.1.14417 WP_000537418.1.14432 WP_000537418.1.14451 WP_000537418.1.14453 WP_000537418.1.14468 WP_000537418.1.14493 WP_000537418.1.14499 WP_000537418.1.14501 WP_000537418.1.14508 WP_000537418.1.14536 WP_000537418.1.14582 WP_000537418.1.14601 WP_000537418.1.1461 WP_000537418.1.14621 WP_000537418.1.14648 WP_000537418.1.14661 WP_000537418.1.14672 WP_000537418.1.14678 WP_000537418.1.14687 WP_000537418.1.14711 WP_000537418.1.14748 WP_000537418.1.14749 WP_000537418.1.14811 WP_000537418.1.14833 WP_000537418.1.1486 WP_000537418.1.14861 WP_000537418.1.14871 WP_000537418.1.14879 WP_000537418.1.14958 WP_000537418.1.14965 WP_000537418.1.14977 WP_000537418.1.14992 WP_000537418.1.14993 WP_000537418.1.15007 WP_000537418.1.1508 WP_000537418.1.15087 WP_000537418.1.1510 WP_000537418.1.1512 WP_000537418.1.15121 WP_000537418.1.15138 WP_000537418.1.15148 WP_000537418.1.15177 WP_000537418.1.15191 WP_000537418.1.15193 WP_000537418.1.15221 WP_000537418.1.15245 WP_000537418.1.15252 WP_000537418.1.15259 WP_000537418.1.15270 WP_000537418.1.15277 WP_000537418.1.15282 WP_000537418.1.15287 WP_000537418.1.153 WP_000537418.1.15300 WP_000537418.1.15332 WP_000537418.1.15356 WP_000537418.1.15377 WP_000537418.1.15416 WP_000537418.1.1543 WP_000537418.1.15444 WP_000537418.1.15464 WP_000537418.1.15469 WP_000537418.1.15496 WP_000537418.1.15503 WP_000537418.1.15521 WP_000537418.1.15527 WP_000537418.1.15528 WP_000537418.1.15565 WP_000537418.1.15576 WP_000537418.1.1559 WP_000537418.1.15593 WP_000537418.1.1561 WP_000537418.1.15620 WP_000537418.1.15626 WP_000537418.1.15645 WP_000537418.1.15702 WP_000537418.1.15707 WP_000537418.1.15740 WP_000537418.1.15747 WP_000537418.1.15752 WP_000537418.1.15762 WP_000537418.1.15767 WP_000537418.1.15768 WP_000537418.1.15771 WP_000537418.1.15782 WP_000537418.1.15791 WP_000537418.1.1580 WP_000537418.1.15809 WP_000537418.1.1582 WP_000537418.1.15855 WP_000537418.1.1588 WP_000537418.1.15894 WP_000537418.1.15945 WP_000537418.1.15983 WP_000537418.1.16014 WP_000537418.1.16015 WP_000537418.1.16034 WP_000537418.1.16042 WP_000537418.1.16075 WP_000537418.1.16086 WP_000537418.1.16087 WP_000537418.1.1609 WP_000537418.1.16102 WP_000537418.1.16111 WP_000537418.1.16133 WP_000537418.1.16154 WP_000537418.1.16171 WP_000537418.1.16179 WP_000537418.1.16188 WP_000537418.1.16194 WP_000537418.1.1621 WP_000537418.1.16222 WP_000537418.1.16272 WP_000537418.1.16294 WP_000537418.1.163 WP_000537418.1.16303 WP_000537418.1.1634 WP_000537418.1.16387 WP_000537418.1.16388 WP_000537418.1.16435 WP_000537418.1.16463 WP_000537418.1.16481 WP_000537418.1.16482 WP_000537418.1.16532 WP_000537418.1.16539 WP_000537418.1.16541 WP_000537418.1.1655 WP_000537418.1.16577 WP_000537418.1.16592 WP_000537418.1.16604 WP_000537418.1.16640 WP_000537418.1.16648 WP_000537418.1.16669 WP_000537418.1.16715 WP_000537418.1.16721 WP_000537418.1.1673 WP_000537418.1.16745 WP_000537418.1.16752 WP_000537418.1.16766 WP_000537418.1.16805 WP_000537418.1.16818 WP_000537418.1.16845 WP_000537418.1.16861 WP_000537418.1.16862 WP_000537418.1.16894 WP_000537418.1.16970 WP_000537418.1.16992 WP_000537418.1.17018 WP_000537418.1.17042 WP_000537418.1.17084 WP_000537418.1.17085 WP_000537418.1.17087 WP_000537418.1.17089 WP_000537418.1.1710 WP_000537418.1.17101 WP_000537418.1.17102 WP_000537418.1.17109 WP_000537418.1.17111 WP_000537418.1.17114 WP_000537418.1.17119 WP_000537418.1.17123 WP_000537418.1.17150 WP_000537418.1.17170 WP_000537418.1.17172 WP_000537418.1.17182 WP_000537418.1.17186 WP_000537418.1.17187 WP_000537418.1.17205 WP_000537418.1.17216 WP_000537418.1.17230 WP_000537418.1.17242 WP_000537418.1.1726 WP_000537418.1.17267 WP_000537418.1.17282 WP_000537418.1.17290 WP_000537418.1.17297 WP_000537418.1.17300 WP_000537418.1.17301 WP_000537418.1.1731 WP_000537418.1.17356 WP_000537418.1.17360 WP_000537418.1.17373 WP_000537418.1.17386 WP_000537418.1.17389 WP_000537418.1.17392 WP_000537418.1.17403 WP_000537418.1.17410 WP_000537418.1.17415 WP_000537418.1.17417 WP_000537418.1.17432 WP_000537418.1.17441 WP_000537418.1.17534 WP_000537418.1.1754 WP_000537418.1.1755 WP_000537418.1.17570 WP_000537418.1.17577 WP_000537418.1.17595 WP_000537418.1.17623 WP_000537418.1.1763 WP_000537418.1.1766 WP_000537418.1.1769 WP_000537418.1.17701 WP_000537418.1.17734 WP_000537418.1.17765 WP_000537418.1.1778 WP_000537418.1.17802 WP_000537418.1.17829 WP_000537418.1.17831 WP_000537418.1.17836 WP_000537418.1.17889 WP_000537418.1.17904 WP_000537418.1.17920 WP_000537418.1.17952 WP_000537418.1.17961 WP_000537418.1.17963 WP_000537418.1.17984 WP_000537418.1.18000 WP_000537418.1.18006 WP_000537418.1.18050 WP_000537418.1.18064 WP_000537418.1.18112 WP_000537418.1.18133 WP_000537418.1.18134 WP_000537418.1.18136 WP_000537418.1.18175 WP_000537418.1.18225 WP_000537418.1.18226 WP_000537418.1.18311 WP_000537418.1.18326 WP_000537418.1.18329 WP_000537418.1.18338 WP_000537418.1.1834 WP_000537418.1.18340 WP_000537418.1.18354 WP_000537418.1.18381 WP_000537418.1.18402 WP_000537418.1.18410 WP_000537418.1.18436 WP_000537418.1.18482 WP_000537418.1.18511 WP_000537418.1.18519 WP_000537418.1.18530 WP_000537418.1.18550 WP_000537418.1.18583 WP_000537418.1.18588 WP_000537418.1.18617 WP_000537418.1.18628 WP_000537418.1.18649 WP_000537418.1.18650 WP_000537418.1.1866 WP_000537418.1.1867 WP_000537418.1.18675 WP_000537418.1.18714 WP_000537418.1.18726 WP_000537418.1.188 WP_000537418.1.18806 WP_000537418.1.1881 WP_000537418.1.18837 WP_000537418.1.18858 WP_000537418.1.18874 WP_000537418.1.18876 WP_000537418.1.18899 WP_000537418.1.18923 WP_000537418.1.18936 WP_000537418.1.18995 WP_000537418.1.1903 WP_000537418.1.19039 WP_000537418.1.1906 WP_000537418.1.19075 WP_000537418.1.1909 WP_000537418.1.19090 WP_000537418.1.191 WP_000537418.1.19113 WP_000537418.1.19114 WP_000537418.1.19122 WP_000537418.1.19140 WP_000537418.1.19147 WP_000537418.1.1915 WP_000537418.1.19150 WP_000537418.1.19194 WP_000537418.1.19205 WP_000537418.1.1925 WP_000537418.1.19277 WP_000537418.1.19297 WP_000537418.1.193 WP_000537418.1.19312 WP_000537418.1.19313 WP_000537418.1.19314 WP_000537418.1.19315 WP_000537418.1.19332 WP_000537418.1.19338 WP_000537418.1.19347 WP_000537418.1.19350 WP_000537418.1.19361 WP_000537418.1.19389 WP_000537418.1.19397 WP_000537418.1.19419 WP_000537418.1.19424 WP_000537418.1.19448 WP_000537418.1.19478 WP_000537418.1.19487 WP_000537418.1.19494 WP_000537418.1.19544 WP_000537418.1.19581 WP_000537418.1.19602 WP_000537418.1.1963 WP_000537418.1.19644 WP_000537418.1.19651 WP_000537418.1.19661 WP_000537418.1.19684 WP_000537418.1.19691 WP_000537418.1.19758 WP_000537418.1.19778 WP_000537418.1.19795 WP_000537418.1.1982 WP_000537418.1.19838 WP_000537418.1.19840 WP_000537418.1.19845 WP_000537418.1.19847 WP_000537418.1.19873 WP_000537418.1.19878 WP_000537418.1.19889 WP_000537418.1.19940 WP_000537418.1.19945 WP_000537418.1.19957 WP_000537418.1.19994 WP_000537418.1.20025 WP_000537418.1.2005 WP_000537418.1.20096 WP_000537418.1.20114 WP_000537418.1.20129 WP_000537418.1.2015 WP_000537418.1.20151 WP_000537418.1.20157 WP_000537418.1.20159 WP_000537418.1.20164 WP_000537418.1.20166 WP_000537418.1.20170 WP_000537418.1.20178 WP_000537418.1.20183 WP_000537418.1.20192 WP_000537418.1.20215 WP_000537418.1.2022 WP_000537418.1.20230 WP_000537418.1.20251 WP_000537418.1.20264 WP_000537418.1.20277 WP_000537418.1.20290 WP_000537418.1.20308 WP_000537418.1.20318 WP_000537418.1.20325 WP_000537418.1.20331 WP_000537418.1.20370 WP_000537418.1.20445 WP_000537418.1.20449 WP_000537418.1.20480 WP_000537418.1.20483 WP_000537418.1.20493 WP_000537418.1.20506 WP_000537418.1.20519 WP_000537418.1.20536 WP_000537418.1.20546 WP_000537418.1.20549 WP_000537418.1.20594 WP_000537418.1.20596 WP_000537418.1.20630 WP_000537418.1.20636 WP_000537418.1.20638 WP_000537418.1.20662 WP_000537418.1.20668 WP_000537418.1.20691 WP_000537418.1.20724 WP_000537418.1.20730 WP_000537418.1.20737 WP_000537418.1.20745 WP_000537418.1.20785 WP_000537418.1.20813 WP_000537418.1.20824 WP_000537418.1.20831 WP_000537418.1.20841 WP_000537418.1.20848 WP_000537418.1.20893 WP_000537418.1.2093 WP_000537418.1.2094 WP_000537418.1.20941 WP_000537418.1.20943 WP_000537418.1.20950 WP_000537418.1.20958 WP_000537418.1.20982 WP_000537418.1.20989 WP_000537418.1.2100 WP_000537418.1.21017 WP_000537418.1.21020 WP_000537418.1.21022 WP_000537418.1.21024 WP_000537418.1.21033 WP_000537418.1.21041 WP_000537418.1.21057 WP_000537418.1.21059 WP_000537418.1.21104 WP_000537418.1.21122 WP_000537418.1.21129 WP_000537418.1.2113 WP_000537418.1.21131 WP_000537418.1.21171 WP_000537418.1.21197 WP_000537418.1.21248 WP_000537418.1.21277 WP_000537418.1.21305 WP_000537418.1.21320 WP_000537418.1.21336 WP_000537418.1.2142 WP_000537418.1.21441 WP_000537418.1.21470 WP_000537418.1.21508 WP_000537418.1.21519 WP_000537418.1.2156 WP_000537418.1.21573 WP_000537418.1.21578 WP_000537418.1.21596 WP_000537418.1.21628 WP_000537418.1.21637 WP_000537418.1.2164 WP_000537418.1.21661 WP_000537418.1.21666 WP_000537418.1.21668 WP_000537418.1.21673 WP_000537418.1.21696 WP_000537418.1.21727 WP_000537418.1.21733 WP_000537418.1.21756 WP_000537418.1.21758 WP_000537418.1.21762 WP_000537418.1.21771 WP_000537418.1.21811 WP_000537418.1.21812 WP_000537418.1.21823 WP_000537418.1.21915 WP_000537418.1.21945 WP_000537418.1.21948 WP_000537418.1.21962 WP_000537418.1.21992 WP_000537418.1.22060 WP_000537418.1.22113 WP_000537418.1.22138 WP_000537418.1.2218 WP_000537418.1.22195 WP_000537418.1.22204 WP_000537418.1.22251 WP_000537418.1.22268 WP_000537418.1.22269 WP_000537418.1.22291 WP_000537418.1.22295 WP_000537418.1.22304 WP_000537418.1.22314 WP_000537418.1.22325 WP_000537418.1.22350 WP_000537418.1.22359 WP_000537418.1.22363 WP_000537418.1.22381 WP_000537418.1.22450 WP_000537418.1.22470 WP_000537418.1.22494 WP_000537418.1.22501 WP_000537418.1.22571 WP_000537418.1.22572 WP_000537418.1.22574 WP_000537418.1.22579 WP_000537418.1.22594 WP_000537418.1.22631 WP_000537418.1.22632 WP_000537418.1.22641 WP_000537418.1.22649 WP_000537418.1.22669 WP_000537418.1.22685 WP_000537418.1.22690 WP_000537418.1.22743 WP_000537418.1.22756 WP_000537418.1.22759 WP_000537418.1.22765 WP_000537418.1.22777 WP_000537418.1.22783 WP_000537418.1.22809 WP_000537418.1.22827 WP_000537418.1.22830 WP_000537418.1.22846 WP_000537418.1.22868 WP_000537418.1.22875 WP_000537418.1.22878 WP_000537418.1.22885 WP_000537418.1.22908 WP_000537418.1.22925 WP_000537418.1.22961 WP_000537418.1.22990 WP_000537418.1.2300 WP_000537418.1.23005 WP_000537418.1.23026 WP_000537418.1.23035 WP_000537418.1.23042 WP_000537418.1.23044 WP_000537418.1.23045 WP_000537418.1.23057 WP_000537418.1.23062 WP_000537418.1.23073 WP_000537418.1.23078 WP_000537418.1.23081 WP_000537418.1.23090 WP_000537418.1.23105 WP_000537418.1.23115 WP_000537418.1.23120 WP_000537418.1.23135 WP_000537418.1.23241 WP_000537418.1.2325 WP_000537418.1.23257 WP_000537418.1.23270 WP_000537418.1.23285 WP_000537418.1.23290 WP_000537418.1.23293 WP_000537418.1.23323 WP_000537418.1.23352 WP_000537418.1.23355 WP_000537418.1.23376 WP_000537418.1.23378 WP_000537418.1.23383 WP_000537418.1.23393 WP_000537418.1.23443 WP_000537418.1.23456 WP_000537418.1.23467 WP_000537418.1.23487 WP_000537418.1.23511 WP_000537418.1.23527 WP_000537418.1.2353 WP_000537418.1.23549 WP_000537418.1.23554 WP_000537418.1.23561 WP_000537418.1.23563 WP_000537418.1.23584 WP_000537418.1.2362 WP_000537418.1.23640 WP_000537418.1.23660 WP_000537418.1.23676 WP_000537418.1.23729 WP_000537418.1.23765 WP_000537418.1.23790 WP_000537418.1.23795 WP_000537418.1.23806 WP_000537418.1.23812 WP_000537418.1.23838 WP_000537418.1.2388 WP_000537418.1.23881 WP_000537418.1.23886 WP_000537418.1.23895 WP_000537418.1.23898 WP_000537418.1.23899 WP_000537418.1.23914 WP_000537418.1.23915 WP_000537418.1.23931 WP_000537418.1.23945 WP_000537418.1.23950 WP_000537418.1.23953 WP_000537418.1.23970 WP_000537418.1.23971 WP_000537418.1.23973 WP_000537418.1.23984 WP_000537418.1.24 WP_000537418.1.24024 WP_000537418.1.24045 WP_000537418.1.24051 WP_000537418.1.24058 WP_000537418.1.24068 WP_000537418.1.24070 WP_000537418.1.24089 WP_000537418.1.24120 WP_000537418.1.24122 WP_000537418.1.24124 WP_000537418.1.24136 WP_000537418.1.2418 WP_000537418.1.24194 WP_000537418.1.24233 WP_000537418.1.24278 WP_000537418.1.2428 WP_000537418.1.24283 WP_000537418.1.24290 WP_000537418.1.24304 WP_000537418.1.24316 WP_000537418.1.24341 WP_000537418.1.24362 WP_000537418.1.2437 WP_000537418.1.24374 WP_000537418.1.24381 WP_000537418.1.24383 WP_000537418.1.24473 WP_000537418.1.24483 WP_000537418.1.24485 WP_000537418.1.24499 WP_000537418.1.24533 WP_000537418.1.24536 WP_000537418.1.2456 WP_000537418.1.24560 WP_000537418.1.24570 WP_000537418.1.24575 WP_000537418.1.24583 WP_000537418.1.24616 WP_000537418.1.24634 WP_000537418.1.24641 WP_000537418.1.24642 WP_000537418.1.24650 WP_000537418.1.24695 WP_000537418.1.24753 WP_000537418.1.24783 WP_000537418.1.2479 WP_000537418.1.24791 WP_000537418.1.24799 WP_000537418.1.24849 WP_000537418.1.24854 WP_000537418.1.24870 WP_000537418.1.24899 WP_000537418.1.24929 WP_000537418.1.24939 WP_000537418.1.24946 WP_000537418.1.24981 WP_000537418.1.24982 WP_000537418.1.25039 WP_000537418.1.2504 WP_000537418.1.25060 WP_000537418.1.25076 WP_000537418.1.25082 WP_000537418.1.25085 WP_000537418.1.25086 WP_000537418.1.25087 WP_000537418.1.25088 WP_000537418.1.25126 WP_000537418.1.25141 WP_000537418.1.25183 WP_000537418.1.25201 WP_000537418.1.25203 WP_000537418.1.25289 WP_000537418.1.25305 WP_000537418.1.25312 WP_000537418.1.25324 WP_000537418.1.25346 WP_000537418.1.2537 WP_000537418.1.25378 WP_000537418.1.254 WP_000537418.1.25403 WP_000537418.1.25414 WP_000537418.1.2543 WP_000537418.1.255 WP_000537418.1.25517 WP_000537418.1.25525 WP_000537418.1.25526 WP_000537418.1.25548 WP_000537418.1.25577 WP_000537418.1.2558 WP_000537418.1.25598 WP_000537418.1.25602 WP_000537418.1.25631 WP_000537418.1.25643 WP_000537418.1.25652 WP_000537418.1.25713 WP_000537418.1.25717 WP_000537418.1.25718 WP_000537418.1.25726 WP_000537418.1.25753 WP_000537418.1.25794 WP_000537418.1.25819 WP_000537418.1.25831 WP_000537418.1.25832 WP_000537418.1.25843 WP_000537418.1.25855 WP_000537418.1.2589 WP_000537418.1.25915 WP_000537418.1.25945 WP_000537418.1.25996 WP_000537418.1.26048 WP_000537418.1.26055 WP_000537418.1.26061 WP_000537418.1.26066 WP_000537418.1.26100 WP_000537418.1.26105 WP_000537418.1.2612 WP_000537418.1.26121 WP_000537418.1.26125 WP_000537418.1.26130 WP_000537418.1.26134 WP_000537418.1.26135 WP_000537418.1.26150 WP_000537418.1.26161 WP_000537418.1.26191 WP_000537418.1.26246 WP_000537418.1.26264 WP_000537418.1.26270 WP_000537418.1.26325 WP_000537418.1.26331 WP_000537418.1.2637 WP_000537418.1.26379 WP_000537418.1.26391 WP_000537418.1.26401 WP_000537418.1.2642 WP_000537418.1.26467 WP_000537418.1.26474 WP_000537418.1.26479 WP_000537418.1.26480 WP_000537418.1.26525 WP_000537418.1.26569 WP_000537418.1.26570 WP_000537418.1.26575 WP_000537418.1.26588 WP_000537418.1.26590 WP_000537418.1.26598 WP_000537418.1.26609 WP_000537418.1.26613 WP_000537418.1.26644 WP_000537418.1.26658 WP_000537418.1.26683 WP_000537418.1.26716 WP_000537418.1.26720 WP_000537418.1.26736 WP_000537418.1.26761 WP_000537418.1.26766 WP_000537418.1.26878 WP_000537418.1.26912 WP_000537418.1.26941 WP_000537418.1.26943 WP_000537418.1.26975 WP_000537418.1.26998 WP_000537418.1.27019 WP_000537418.1.27057 WP_000537418.1.27060 WP_000537418.1.27098 WP_000537418.1.27101 WP_000537418.1.27105 WP_000537418.1.2712 WP_000537418.1.27134 WP_000537418.1.27141 WP_000537418.1.27175 WP_000537418.1.27214 WP_000537418.1.27234 WP_000537418.1.27260 WP_000537418.1.27280 WP_000537418.1.27283 WP_000537418.1.27287 WP_000537418.1.27292 WP_000537418.1.27310 WP_000537418.1.27330 WP_000537418.1.27338 WP_000537418.1.27367 WP_000537418.1.27373 WP_000537418.1.27424 WP_000537418.1.27426 WP_000537418.1.27445 WP_000537418.1.27451 WP_000537418.1.27504 WP_000537418.1.27518 WP_000537418.1.27524 WP_000537418.1.27560 WP_000537418.1.27580 WP_000537418.1.27611 WP_000537418.1.27683 WP_000537418.1.27691 WP_000537418.1.27698 WP_000537418.1.27723 WP_000537418.1.27741 WP_000537418.1.27742 WP_000537418.1.27749 WP_000537418.1.27758 WP_000537418.1.27774 WP_000537418.1.27786 WP_000537418.1.27856 WP_000537418.1.27876 WP_000537418.1.27879 WP_000537418.1.27923 WP_000537418.1.27971 WP_000537418.1.28109 WP_000537418.1.2811 WP_000537418.1.28110 WP_000537418.1.28128 WP_000537418.1.28143 WP_000537418.1.28168 WP_000537418.1.28184 WP_000537418.1.2823 WP_000537418.1.2826 WP_000537418.1.28268 WP_000537418.1.28271 WP_000537418.1.28305 WP_000537418.1.28371 WP_000537418.1.28401 WP_000537418.1.28414 WP_000537418.1.28433 WP_000537418.1.28440 WP_000537418.1.28480 WP_000537418.1.28496 WP_000537418.1.28509 WP_000537418.1.28523 WP_000537418.1.28540 WP_000537418.1.28551 WP_000537418.1.28554 WP_000537418.1.28662 WP_000537418.1.28683 WP_000537418.1.28697 WP_000537418.1.28711 WP_000537418.1.28734 WP_000537418.1.28762 WP_000537418.1.28769 WP_000537418.1.28791 WP_000537418.1.28809 WP_000537418.1.2881 WP_000537418.1.28835 WP_000537418.1.28879 WP_000537418.1.28919 WP_000537418.1.28950 WP_000537418.1.28953 WP_000537418.1.28982 WP_000537418.1.28994 WP_000537418.1.29001 WP_000537418.1.29013 WP_000537418.1.29016 WP_000537418.1.29061 WP_000537418.1.29079 WP_000537418.1.29082 WP_000537418.1.291 WP_000537418.1.29100 WP_000537418.1.29125 WP_000537418.1.29126 WP_000537418.1.29128 WP_000537418.1.29146 WP_000537418.1.29150 WP_000537418.1.29176 WP_000537418.1.29194 WP_000537418.1.29197 WP_000537418.1.29202 WP_000537418.1.29206 WP_000537418.1.29221 WP_000537418.1.29230 WP_000537418.1.29239 WP_000537418.1.29252 WP_000537418.1.2926 WP_000537418.1.29404 WP_000537418.1.2942 WP_000537418.1.29429 WP_000537418.1.2945 WP_000537418.1.29486 WP_000537418.1.29495 WP_000537418.1.29497 WP_000537418.1.29503 WP_000537418.1.2952 WP_000537418.1.2954 WP_000537418.1.29556 WP_000537418.1.29564 WP_000537418.1.29590 WP_000537418.1.29597 WP_000537418.1.29618 WP_000537418.1.29643 WP_000537418.1.29669 WP_000537418.1.29683 WP_000537418.1.29699 WP_000537418.1.29715 WP_000537418.1.29724 WP_000537418.1.29740 WP_000537418.1.29746 WP_000537418.1.29752 WP_000537418.1.2978 WP_000537418.1.29812 WP_000537418.1.29818 WP_000537418.1.29840 WP_000537418.1.2986 WP_000537418.1.29874 WP_000537418.1.29933 WP_000537418.1.29967 WP_000537418.1.29976 WP_000537418.1.29992 WP_000537418.1.30 WP_000537418.1.30004 WP_000537418.1.30016 WP_000537418.1.30019 WP_000537418.1.30052 WP_000537418.1.30064 WP_000537418.1.30098 WP_000537418.1.30105 WP_000537418.1.30141 WP_000537418.1.30164 WP_000537418.1.30221 WP_000537418.1.30231 WP_000537418.1.30247 WP_000537418.1.30253 WP_000537418.1.30347 WP_000537418.1.30391 WP_000537418.1.30399 WP_000537418.1.30401 WP_000537418.1.30428 WP_000537418.1.3045 WP_000537418.1.30472 WP_000537418.1.30476 WP_000537418.1.30479 WP_000537418.1.30497 WP_000537418.1.30546 WP_000537418.1.30554 WP_000537418.1.30580 WP_000537418.1.306 WP_000537418.1.3063 WP_000537418.1.30630 WP_000537418.1.30637 WP_000537418.1.30639 WP_000537418.1.30700 WP_000537418.1.30733 WP_000537418.1.30742 WP_000537418.1.30749 WP_000537418.1.30783 WP_000537418.1.30843 WP_000537418.1.30866 WP_000537418.1.30906 WP_000537418.1.30918 WP_000537418.1.30960 WP_000537418.1.30993 WP_000537418.1.30999 WP_000537418.1.31000 WP_000537418.1.31009 WP_000537418.1.31026 WP_000537418.1.31055 WP_000537418.1.31089 WP_000537418.1.31142 WP_000537418.1.31188 WP_000537418.1.312 WP_000537418.1.31211 WP_000537418.1.31252 WP_000537418.1.31295 WP_000537418.1.31340 WP_000537418.1.31353 WP_000537418.1.31379 WP_000537418.1.3140 WP_000537418.1.31401 WP_000537418.1.31407 WP_000537418.1.31421 WP_000537418.1.31431 WP_000537418.1.31434 WP_000537418.1.31482 WP_000537418.1.31506 WP_000537418.1.31527 WP_000537418.1.31575 WP_000537418.1.31614 WP_000537418.1.31618 WP_000537418.1.31625 WP_000537418.1.31639 WP_000537418.1.31679 WP_000537418.1.31681 WP_000537418.1.3169 WP_000537418.1.31696 WP_000537418.1.31709 WP_000537418.1.31715 WP_000537418.1.31736 WP_000537418.1.31740 WP_000537418.1.31801 WP_000537418.1.31803 WP_000537418.1.3181 WP_000537418.1.31833 WP_000537418.1.31835 WP_000537418.1.31839 WP_000537418.1.31860 WP_000537418.1.31866 WP_000537418.1.31898 WP_000537418.1.31899 WP_000537418.1.31903 WP_000537418.1.31924 WP_000537418.1.31928 WP_000537418.1.3193 WP_000537418.1.31956 WP_000537418.1.31978 WP_000537418.1.32020 WP_000537418.1.3203 WP_000537418.1.32037 WP_000537418.1.32049 WP_000537418.1.32063 WP_000537418.1.32078 WP_000537418.1.32089 WP_000537418.1.32093 WP_000537418.1.32094 WP_000537418.1.3212 WP_000537418.1.32121 WP_000537418.1.32127 WP_000537418.1.32138 WP_000537418.1.32143 WP_000537418.1.3215 WP_000537418.1.32173 WP_000537418.1.32184 WP_000537418.1.322 WP_000537418.1.32232 WP_000537418.1.32242 WP_000537418.1.32243 WP_000537418.1.32279 WP_000537418.1.32287 WP_000537418.1.32333 WP_000537418.1.32394 WP_000537418.1.32406 WP_000537418.1.32435 WP_000537418.1.32443 WP_000537418.1.32479 WP_000537418.1.3248 WP_000537418.1.32494 WP_000537418.1.32509 WP_000537418.1.32536 WP_000537418.1.32574 WP_000537418.1.32580 WP_000537418.1.32590 WP_000537418.1.32591 WP_000537418.1.32601 WP_000537418.1.32635 WP_000537418.1.32655 WP_000537418.1.32661 WP_000537418.1.32680 WP_000537418.1.327 WP_000537418.1.32709 WP_000537418.1.32715 WP_000537418.1.32720 WP_000537418.1.32722 WP_000537418.1.32741 WP_000537418.1.32811 WP_000537418.1.32815 WP_000537418.1.32835 WP_000537418.1.32875 WP_000537418.1.32888 WP_000537418.1.32903 WP_000537418.1.32910 WP_000537418.1.32931 WP_000537418.1.3295 WP_000537418.1.32959 WP_000537418.1.32984 WP_000537418.1.32992 WP_000537418.1.33014 WP_000537418.1.33022 WP_000537418.1.33026 WP_000537418.1.33049 WP_000537418.1.33053 WP_000537418.1.33055 WP_000537418.1.33094 WP_000537418.1.33119 WP_000537418.1.33125 WP_000537418.1.33146 WP_000537418.1.33167 WP_000537418.1.33171 WP_000537418.1.33178 WP_000537418.1.3323 WP_000537418.1.33237 WP_000537418.1.33238 WP_000537418.1.33244 WP_000537418.1.33268 WP_000537418.1.33325 WP_000537418.1.33341 WP_000537418.1.33362 WP_000537418.1.334 WP_000537418.1.33408 WP_000537418.1.33413 WP_000537418.1.33422 WP_000537418.1.33424 WP_000537418.1.33475 WP_000537418.1.33476 WP_000537418.1.33502 WP_000537418.1.33512 WP_000537418.1.3354 WP_000537418.1.33545 WP_000537418.1.33561 WP_000537418.1.33595 WP_000537418.1.33631 WP_000537418.1.33638 WP_000537418.1.33648 WP_000537418.1.33667 WP_000537418.1.33680 WP_000537418.1.33729 WP_000537418.1.33736 WP_000537418.1.33745 WP_000537418.1.33746 WP_000537418.1.33751 WP_000537418.1.33780 WP_000537418.1.33799 WP_000537418.1.33823 WP_000537418.1.33853 WP_000537418.1.33854 WP_000537418.1.33879 WP_000537418.1.33888 WP_000537418.1.33914 WP_000537418.1.33948 WP_000537418.1.33952 WP_000537418.1.33973 WP_000537418.1.33979 WP_000537418.1.3398 WP_000537418.1.33981 WP_000537418.1.34003 WP_000537418.1.3401 WP_000537418.1.34032 WP_000537418.1.34094 WP_000537418.1.3411 WP_000537418.1.34124 WP_000537418.1.3415 WP_000537418.1.34204 WP_000537418.1.34206 WP_000537418.1.34224 WP_000537418.1.34269 WP_000537418.1.34270 WP_000537418.1.34273 WP_000537418.1.34277 WP_000537418.1.34332 WP_000537418.1.34363 WP_000537418.1.34380 WP_000537418.1.34383 WP_000537418.1.3439 WP_000537418.1.34397 WP_000537418.1.3444 WP_000537418.1.34440 WP_000537418.1.34444 WP_000537418.1.34464 WP_000537418.1.34500 WP_000537418.1.34525 WP_000537418.1.34532 WP_000537418.1.34538 WP_000537418.1.34541 WP_000537418.1.34557 WP_000537418.1.34605 WP_000537418.1.34655 WP_000537418.1.34668 WP_000537418.1.34680 WP_000537418.1.34682 WP_000537418.1.34686 WP_000537418.1.347 WP_000537418.1.34727 WP_000537418.1.34781 WP_000537418.1.34782 WP_000537418.1.34794 WP_000537418.1.34827 WP_000537418.1.34855 WP_000537418.1.34948 WP_000537418.1.34983 WP_000537418.1.34990 WP_000537418.1.34993 WP_000537418.1.35006 WP_000537418.1.35039 WP_000537418.1.35114 WP_000537418.1.3515 WP_000537418.1.35180 WP_000537418.1.35186 WP_000537418.1.35195 WP_000537418.1.35202 WP_000537418.1.35204 WP_000537418.1.3521 WP_000537418.1.35211 WP_000537418.1.35316 WP_000537418.1.35349 WP_000537418.1.35360 WP_000537418.1.35376 WP_000537418.1.3539 WP_000537418.1.35393 WP_000537418.1.35398 WP_000537418.1.35448 WP_000537418.1.35464 WP_000537418.1.35465 WP_000537418.1.35466 WP_000537418.1.35468 WP_000537418.1.3550 WP_000537418.1.35552 WP_000537418.1.35581 WP_000537418.1.3560 WP_000537418.1.35651 WP_000537418.1.35653 WP_000537418.1.35654 WP_000537418.1.35704 WP_000537418.1.35724 WP_000537418.1.35740 WP_000537418.1.35904 WP_000537418.1.35922 WP_000537418.1.35927 WP_000537418.1.35934 WP_000537418.1.35959 WP_000537418.1.36010 WP_000537418.1.36040 WP_000537418.1.36042 WP_000537418.1.36070 WP_000537418.1.36071 WP_000537418.1.36085 WP_000537418.1.36094 WP_000537418.1.36159 WP_000537418.1.36164 WP_000537418.1.36166 WP_000537418.1.36182 WP_000537418.1.3620 WP_000537418.1.36212 WP_000537418.1.36281 WP_000537418.1.36299 WP_000537418.1.36334 WP_000537418.1.36386 WP_000537418.1.36393 WP_000537418.1.36412 WP_000537418.1.36426 WP_000537418.1.36453 WP_000537418.1.36496 WP_000537418.1.36500 WP_000537418.1.36507 WP_000537418.1.36523 WP_000537418.1.36531 WP_000537418.1.36537 WP_000537418.1.36626 WP_000537418.1.36627 WP_000537418.1.36628 WP_000537418.1.3671 WP_000537418.1.36739 WP_000537418.1.36746 WP_000537418.1.36747 WP_000537418.1.36767 WP_000537418.1.36806 WP_000537418.1.36812 WP_000537418.1.36826 WP_000537418.1.36833 WP_000537418.1.36925 WP_000537418.1.36971 WP_000537418.1.36975 WP_000537418.1.37006 WP_000537418.1.37020 WP_000537418.1.37049 WP_000537418.1.37057 WP_000537418.1.37076 WP_000537418.1.37099 WP_000537418.1.37101 WP_000537418.1.37102 WP_000537418.1.37122 WP_000537418.1.37146 WP_000537418.1.37206 WP_000537418.1.3723 WP_000537418.1.37233 WP_000537418.1.37252 WP_000537418.1.37261 WP_000537418.1.3730 WP_000537418.1.37329 WP_000537418.1.37334 WP_000537418.1.37337 WP_000537418.1.37352 WP_000537418.1.37371 WP_000537418.1.37372 WP_000537418.1.37419 WP_000537418.1.37433 WP_000537418.1.37445 WP_000537418.1.37476 WP_000537418.1.37485 WP_000537418.1.3749 WP_000537418.1.37510 WP_000537418.1.37538 WP_000537418.1.37543 WP_000537418.1.37554 WP_000537418.1.37576 WP_000537418.1.37588 WP_000537418.1.3762 WP_000537418.1.37634 WP_000537418.1.377 WP_000537418.1.37731 WP_000537418.1.37745 WP_000537418.1.37750 WP_000537418.1.37758 WP_000537418.1.37762 WP_000537418.1.37766 WP_000537418.1.37769 WP_000537418.1.37773 WP_000537418.1.37847 WP_000537418.1.37852 WP_000537418.1.3788 WP_000537418.1.37880 WP_000537418.1.37887 WP_000537418.1.37897 WP_000537418.1.37923 WP_000537418.1.37926 WP_000537418.1.37940 WP_000537418.1.3795 WP_000537418.1.37964 WP_000537418.1.37995 WP_000537418.1.38033 WP_000537418.1.38043 WP_000537418.1.38050 WP_000537418.1.38063 WP_000537418.1.38080 WP_000537418.1.38081 WP_000537418.1.38085 WP_000537418.1.38103 WP_000537418.1.38105 WP_000537418.1.38107 WP_000537418.1.3811 WP_000537418.1.38120 WP_000537418.1.38155 WP_000537418.1.38162 WP_000537418.1.38182 WP_000537418.1.38211 WP_000537418.1.3822 WP_000537418.1.38257 WP_000537418.1.38264 WP_000537418.1.38306 WP_000537418.1.38314 WP_000537418.1.38323 WP_000537418.1.38363 WP_000537418.1.38369 WP_000537418.1.38371 WP_000537418.1.38392 WP_000537418.1.38412 WP_000537418.1.38419 WP_000537418.1.38485 WP_000537418.1.38544 WP_000537418.1.38584 WP_000537418.1.38610 WP_000537418.1.38626 WP_000537418.1.38629 WP_000537418.1.38636 WP_000537418.1.38694 WP_000537418.1.38722 WP_000537418.1.38777 WP_000537418.1.38811 WP_000537418.1.38827 WP_000537418.1.38835 WP_000537418.1.38896 WP_000537418.1.389 WP_000537418.1.38911 WP_000537418.1.38920 WP_000537418.1.38935 WP_000537418.1.38950 WP_000537418.1.38958 WP_000537418.1.39015 WP_000537418.1.3903 WP_000537418.1.39037 WP_000537418.1.3904 WP_000537418.1.39042 WP_000537418.1.39111 WP_000537418.1.39123 WP_000537418.1.39150 WP_000537418.1.39155 WP_000537418.1.39157 WP_000537418.1.39164 WP_000537418.1.39167 WP_000537418.1.39171 WP_000537418.1.39180 WP_000537418.1.3921 WP_000537418.1.39249 WP_000537418.1.39268 WP_000537418.1.39302 WP_000537418.1.39305 WP_000537418.1.39310 WP_000537418.1.39342 WP_000537418.1.39356 WP_000537418.1.39365 WP_000537418.1.39367 WP_000537418.1.39373 WP_000537418.1.39402 WP_000537418.1.39415 WP_000537418.1.39430 WP_000537418.1.39468 WP_000537418.1.39481 WP_000537418.1.39492 WP_000537418.1.39509 WP_000537418.1.39531 WP_000537418.1.3954 WP_000537418.1.39564 WP_000537418.1.39580 WP_000537418.1.39594 WP_000537418.1.39601 WP_000537418.1.39606 WP_000537418.1.39607 WP_000537418.1.39610 WP_000537418.1.39626 WP_000537418.1.39646 WP_000537418.1.39690 WP_000537418.1.3970 WP_000537418.1.39715 WP_000537418.1.39730 WP_000537418.1.39758 WP_000537418.1.39780 WP_000537418.1.39796 WP_000537418.1.3980 WP_000537418.1.39818 WP_000537418.1.39820 WP_000537418.1.39822 WP_000537418.1.39829 WP_000537418.1.39870 WP_000537418.1.39938 WP_000537418.1.39966 WP_000537418.1.39970 WP_000537418.1.39973 WP_000537418.1.39992 WP_000537418.1.39998 WP_000537418.1.40013 WP_000537418.1.40016 WP_000537418.1.40113 WP_000537418.1.40121 WP_000537418.1.40147 WP_000537418.1.40159 WP_000537418.1.40183 WP_000537418.1.40192 WP_000537418.1.4020 WP_000537418.1.40212 WP_000537418.1.40218 WP_000537418.1.40234 WP_000537418.1.40238 WP_000537418.1.40298 WP_000537418.1.4030 WP_000537418.1.40315 WP_000537418.1.40319 WP_000537418.1.40335 WP_000537418.1.40382 WP_000537418.1.40389 WP_000537418.1.40391 WP_000537418.1.40403 WP_000537418.1.40445 WP_000537418.1.4049 WP_000537418.1.40499 WP_000537418.1.40502 WP_000537418.1.40509 WP_000537418.1.40524 WP_000537418.1.40548 WP_000537418.1.40549 WP_000537418.1.40563 WP_000537418.1.40596 WP_000537418.1.40599 WP_000537418.1.406 WP_000537418.1.40617 WP_000537418.1.40623 WP_000537418.1.40629 WP_000537418.1.40668 WP_000537418.1.40686 WP_000537418.1.40712 WP_000537418.1.40742 WP_000537418.1.40758 WP_000537418.1.40781 WP_000537418.1.40793 WP_000537418.1.4081 WP_000537418.1.40813 WP_000537418.1.40815 WP_000537418.1.4082 WP_000537418.1.40833 WP_000537418.1.40865 WP_000537418.1.40882 WP_000537418.1.40898 WP_000537418.1.40900 WP_000537418.1.40912 WP_000537418.1.40937 WP_000537418.1.40952 WP_000537418.1.40965 WP_000537418.1.4103 WP_000537418.1.41037 WP_000537418.1.41045 WP_000537418.1.41060 WP_000537418.1.41125 WP_000537418.1.41147 WP_000537418.1.41206 WP_000537418.1.41230 WP_000537418.1.41239 WP_000537418.1.41244 WP_000537418.1.41259 WP_000537418.1.4126 WP_000537418.1.41263 WP_000537418.1.41287 WP_000537418.1.41294 WP_000537418.1.41315 WP_000537418.1.41330 WP_000537418.1.41363 WP_000537418.1.41368 WP_000537418.1.41371 WP_000537418.1.41401 WP_000537418.1.41402 WP_000537418.1.41407 WP_000537418.1.41417 WP_000537418.1.4142 WP_000537418.1.41436 WP_000537418.1.41457 WP_000537418.1.41466 WP_000537418.1.41478 WP_000537418.1.41479 WP_000537418.1.41483 WP_000537418.1.41484 WP_000537418.1.41530 WP_000537418.1.41536 WP_000537418.1.41539 WP_000537418.1.41545 WP_000537418.1.41556 WP_000537418.1.41566 WP_000537418.1.41606 WP_000537418.1.41613 WP_000537418.1.41621 WP_000537418.1.41651 WP_000537418.1.41654 WP_000537418.1.41712 WP_000537418.1.41718 WP_000537418.1.4172 WP_000537418.1.41734 WP_000537418.1.41740 WP_000537418.1.41752 WP_000537418.1.41778 WP_000537418.1.41780 WP_000537418.1.41782 WP_000537418.1.41784 WP_000537418.1.41812 WP_000537418.1.41813 WP_000537418.1.41826 WP_000537418.1.41837 WP_000537418.1.41849 WP_000537418.1.41900 WP_000537418.1.4193 WP_000537418.1.41960 WP_000537418.1.41964 WP_000537418.1.41988 WP_000537418.1.42022 WP_000537418.1.42027 WP_000537418.1.42033 WP_000537418.1.42036 WP_000537418.1.42060 WP_000537418.1.42073 WP_000537418.1.42095 WP_000537418.1.42096 WP_000537418.1.42113 WP_000537418.1.4213 WP_000537418.1.42159 WP_000537418.1.42179 WP_000537418.1.42209 WP_000537418.1.42214 WP_000537418.1.42221 WP_000537418.1.42226 WP_000537418.1.42233 WP_000537418.1.42252 WP_000537418.1.42277 WP_000537418.1.42284 WP_000537418.1.42300 WP_000537418.1.42318 WP_000537418.1.42359 WP_000537418.1.42367 WP_000537418.1.42369 WP_000537418.1.42376 WP_000537418.1.42415 WP_000537418.1.4242 WP_000537418.1.42432 WP_000537418.1.42447 WP_000537418.1.42456 WP_000537418.1.42480 WP_000537418.1.4250 WP_000537418.1.42513 WP_000537418.1.42522 WP_000537418.1.42594 WP_000537418.1.4261 WP_000537418.1.42661 WP_000537418.1.42669 WP_000537418.1.42728 WP_000537418.1.42748 WP_000537418.1.42749 WP_000537418.1.42750 WP_000537418.1.42761 WP_000537418.1.42770 WP_000537418.1.42771 WP_000537418.1.42791 WP_000537418.1.42813 WP_000537418.1.4282 WP_000537418.1.42828 WP_000537418.1.42830 WP_000537418.1.42832 WP_000537418.1.42863 WP_000537418.1.42879 WP_000537418.1.42891 WP_000537418.1.4290 WP_000537418.1.42918 WP_000537418.1.42936 WP_000537418.1.42937 WP_000537418.1.42950 WP_000537418.1.42962 WP_000537418.1.42966 WP_000537418.1.42975 WP_000537418.1.42987 WP_000537418.1.43013 WP_000537418.1.43035 WP_000537418.1.4306 WP_000537418.1.43079 WP_000537418.1.43121 WP_000537418.1.4313 WP_000537418.1.43132 WP_000537418.1.43137 WP_000537418.1.43140 WP_000537418.1.43166 WP_000537418.1.43174 WP_000537418.1.43177 WP_000537418.1.43196 WP_000537418.1.43213 WP_000537418.1.43239 WP_000537418.1.43324 WP_000537418.1.43363 WP_000537418.1.43374 WP_000537418.1.43384 WP_000537418.1.43389 WP_000537418.1.43444 WP_000537418.1.43448 WP_000537418.1.43455 WP_000537418.1.43469 WP_000537418.1.43473 WP_000537418.1.43474 WP_000537418.1.43489 WP_000537418.1.43536 WP_000537418.1.43566 WP_000537418.1.43604 WP_000537418.1.43642 WP_000537418.1.43720 WP_000537418.1.43750 WP_000537418.1.43754 WP_000537418.1.43769 WP_000537418.1.43798 WP_000537418.1.43804 WP_000537418.1.43816 WP_000537418.1.43837 WP_000537418.1.43858 WP_000537418.1.43911 WP_000537418.1.43925 WP_000537418.1.43939 WP_000537418.1.43989 WP_000537418.1.4400 WP_000537418.1.44020 WP_000537418.1.44029 WP_000537418.1.44040 WP_000537418.1.44075 WP_000537418.1.44088 WP_000537418.1.44096 WP_000537418.1.44100 WP_000537418.1.4411 WP_000537418.1.44115 WP_000537418.1.44125 WP_000537418.1.44162 WP_000537418.1.44165 WP_000537418.1.44166 WP_000537418.1.44203 WP_000537418.1.44238 WP_000537418.1.44264 WP_000537418.1.44273 WP_000537418.1.44285 WP_000537418.1.44287 WP_000537418.1.44292 WP_000537418.1.44314 WP_000537418.1.44324 WP_000537418.1.44365 WP_000537418.1.44389 WP_000537418.1.44424 WP_000537418.1.44426 WP_000537418.1.44452 WP_000537418.1.44461 WP_000537418.1.44488 WP_000537418.1.4449 WP_000537418.1.44524 WP_000537418.1.44539 WP_000537418.1.44561 WP_000537418.1.44570 WP_000537418.1.44587 WP_000537418.1.44608 WP_000537418.1.44610 WP_000537418.1.44661 WP_000537418.1.44686 WP_000537418.1.44724 WP_000537418.1.4473 WP_000537418.1.44733 WP_000537418.1.44756 WP_000537418.1.448 WP_000537418.1.44814 WP_000537418.1.44818 WP_000537418.1.44821 WP_000537418.1.44840 WP_000537418.1.44841 WP_000537418.1.44848 WP_000537418.1.44849 WP_000537418.1.44854 WP_000537418.1.44857 WP_000537418.1.44906 WP_000537418.1.44923 WP_000537418.1.44954 WP_000537418.1.44960 WP_000537418.1.44961 WP_000537418.1.44970 WP_000537418.1.44980 WP_000537418.1.45020 WP_000537418.1.45025 WP_000537418.1.45028 WP_000537418.1.45043 WP_000537418.1.45053 WP_000537418.1.45068 WP_000537418.1.45076 WP_000537418.1.45104 WP_000537418.1.45116 WP_000537418.1.45153 WP_000537418.1.45156 WP_000537418.1.4516 WP_000537418.1.45195 WP_000537418.1.45208 WP_000537418.1.4524 WP_000537418.1.45246 WP_000537418.1.45293 WP_000537418.1.45301 WP_000537418.1.45329 WP_000537418.1.45359 WP_000537418.1.45404 WP_000537418.1.45440 WP_000537418.1.45444 WP_000537418.1.4549 WP_000537418.1.45494 WP_000537418.1.45500 WP_000537418.1.45538 WP_000537418.1.45565 WP_000537418.1.45575 WP_000537418.1.45581 WP_000537418.1.45595 WP_000537418.1.45600 WP_000537418.1.4563 WP_000537418.1.45664 WP_000537418.1.4570 WP_000537418.1.45707 WP_000537418.1.45718 WP_000537418.1.4574 WP_000537418.1.45741 WP_000537418.1.45840 WP_000537418.1.45841 WP_000537418.1.45846 WP_000537418.1.45865 WP_000537418.1.45901 WP_000537418.1.4593 WP_000537418.1.45930 WP_000537418.1.45931 WP_000537418.1.45933 WP_000537418.1.45941 WP_000537418.1.45945 WP_000537418.1.45962 WP_000537418.1.45968 WP_000537418.1.45991 WP_000537418.1.4600 WP_000537418.1.46026 WP_000537418.1.46027 WP_000537418.1.46039 WP_000537418.1.46070 WP_000537418.1.46081 WP_000537418.1.46097 WP_000537418.1.46115 WP_000537418.1.4613 WP_000537418.1.4617 WP_000537418.1.46186 WP_000537418.1.4619 WP_000537418.1.46197 WP_000537418.1.46213 WP_000537418.1.46239 WP_000537418.1.46245 WP_000537418.1.46257 WP_000537418.1.46282 WP_000537418.1.46283 WP_000537418.1.46301 WP_000537418.1.46325 WP_000537418.1.46329 WP_000537418.1.46369 WP_000537418.1.46414 WP_000537418.1.4643 WP_000537418.1.46433 WP_000537418.1.46441 WP_000537418.1.46451 WP_000537418.1.4646 WP_000537418.1.46468 WP_000537418.1.4647 WP_000537418.1.46477 WP_000537418.1.46503 WP_000537418.1.46526 WP_000537418.1.46541 WP_000537418.1.46552 WP_000537418.1.46555 WP_000537418.1.4657 WP_000537418.1.46573 WP_000537418.1.46582 WP_000537418.1.46597 WP_000537418.1.46611 WP_000537418.1.46614 WP_000537418.1.46616 WP_000537418.1.46626 WP_000537418.1.46643 WP_000537418.1.46655 WP_000537418.1.4670 WP_000537418.1.46734 WP_000537418.1.46743 WP_000537418.1.46802 WP_000537418.1.46810 WP_000537418.1.46820 WP_000537418.1.46821 WP_000537418.1.46832 WP_000537418.1.46857 WP_000537418.1.46860 WP_000537418.1.46876 WP_000537418.1.46882 WP_000537418.1.46898 WP_000537418.1.46909 WP_000537418.1.4691 WP_000537418.1.46912 WP_000537418.1.46913 WP_000537418.1.46932 WP_000537418.1.46990 WP_000537418.1.46999 WP_000537418.1.47028 WP_000537418.1.47030 WP_000537418.1.47034 WP_000537418.1.47038 WP_000537418.1.47048 WP_000537418.1.47050 WP_000537418.1.4708 WP_000537418.1.47135 WP_000537418.1.47140 WP_000537418.1.47156 WP_000537418.1.47186 WP_000537418.1.47198 WP_000537418.1.4722 WP_000537418.1.47224 WP_000537418.1.4723 WP_000537418.1.47246 WP_000537418.1.47280 WP_000537418.1.47307 WP_000537418.1.47316 WP_000537418.1.47319 WP_000537418.1.47350 WP_000537418.1.47363 WP_000537418.1.47370 WP_000537418.1.47386 WP_000537418.1.47398 WP_000537418.1.4740 WP_000537418.1.47401 WP_000537418.1.47411 WP_000537418.1.47414 WP_000537418.1.47416 WP_000537418.1.47425 WP_000537418.1.47451 WP_000537418.1.47477 WP_000537418.1.47496 WP_000537418.1.47529 WP_000537418.1.47546 WP_000537418.1.47582 WP_000537418.1.47634 WP_000537418.1.47646 WP_000537418.1.47654 WP_000537418.1.4772 WP_000537418.1.4773 WP_000537418.1.47734 WP_000537418.1.47740 WP_000537418.1.47744 WP_000537418.1.47761 WP_000537418.1.47764 WP_000537418.1.47765 WP_000537418.1.47770 WP_000537418.1.47784 WP_000537418.1.47790 WP_000537418.1.47791 WP_000537418.1.47820 WP_000537418.1.47827 WP_000537418.1.47848 WP_000537418.1.4785 WP_000537418.1.47884 WP_000537418.1.47914 WP_000537418.1.47954 WP_000537418.1.4796 WP_000537418.1.47962 WP_000537418.1.47976 WP_000537418.1.47981 WP_000537418.1.47983 WP_000537418.1.47994 WP_000537418.1.48000 WP_000537418.1.48018 WP_000537418.1.48029 WP_000537418.1.48040 WP_000537418.1.48048 WP_000537418.1.48065 WP_000537418.1.48073 WP_000537418.1.48077 WP_000537418.1.48080 WP_000537418.1.48087 WP_000537418.1.48096 WP_000537418.1.48111 WP_000537418.1.4812 WP_000537418.1.48144 WP_000537418.1.48176 WP_000537418.1.48194 WP_000537418.1.48203 WP_000537418.1.48222 WP_000537418.1.48226 WP_000537418.1.48258 WP_000537418.1.48285 WP_000537418.1.48290 WP_000537418.1.48353 WP_000537418.1.48355 WP_000537418.1.48371 WP_000537418.1.48404 WP_000537418.1.48417 WP_000537418.1.48421 WP_000537418.1.48433 WP_000537418.1.48483 WP_000537418.1.48505 WP_000537418.1.48522 WP_000537418.1.4857 WP_000537418.1.48590 WP_000537418.1.486 WP_000537418.1.48602 WP_000537418.1.48678 WP_000537418.1.48697 WP_000537418.1.4871 WP_000537418.1.48712 WP_000537418.1.48771 WP_000537418.1.48792 WP_000537418.1.48801 WP_000537418.1.48806 WP_000537418.1.48825 WP_000537418.1.48847 WP_000537418.1.48860 WP_000537418.1.48901 WP_000537418.1.48907 WP_000537418.1.48910 WP_000537418.1.48921 WP_000537418.1.48928 WP_000537418.1.48953 WP_000537418.1.48954 WP_000537418.1.48974 WP_000537418.1.49009 WP_000537418.1.49107 WP_000537418.1.49124 WP_000537418.1.49136 WP_000537418.1.49190 WP_000537418.1.49229 WP_000537418.1.49236 WP_000537418.1.49259 WP_000537418.1.4931 WP_000537418.1.49312 WP_000537418.1.49332 WP_000537418.1.49336 WP_000537418.1.49363 WP_000537418.1.49401 WP_000537418.1.49431 WP_000537418.1.49459 WP_000537418.1.49464 WP_000537418.1.49482 WP_000537418.1.4949 WP_000537418.1.49496 WP_000537418.1.49528 WP_000537418.1.49531 WP_000537418.1.49537 WP_000537418.1.49546 WP_000537418.1.49558 WP_000537418.1.49567 WP_000537418.1.49599 WP_000537418.1.49645 WP_000537418.1.49655 WP_000537418.1.49661 WP_000537418.1.49684 WP_000537418.1.497 WP_000537418.1.49733 WP_000537418.1.49740 WP_000537418.1.49747 WP_000537418.1.49768 WP_000537418.1.49771 WP_000537418.1.49774 WP_000537418.1.49777 WP_000537418.1.49856 WP_000537418.1.49861 WP_000537418.1.49883 WP_000537418.1.49900 WP_000537418.1.49902 WP_000537418.1.49950 WP_000537418.1.49954 WP_000537418.1.49987 WP_000537418.1.50006 WP_000537418.1.50008 WP_000537418.1.5003 WP_000537418.1.50036 WP_000537418.1.50078 WP_000537418.1.50098 WP_000537418.1.50110 WP_000537418.1.50113 WP_000537418.1.50136 WP_000537418.1.5017 WP_000537418.1.50182 WP_000537418.1.50196 WP_000537418.1.50207 WP_000537418.1.50230 WP_000537418.1.50258 WP_000537418.1.50262 WP_000537418.1.50269 WP_000537418.1.50273 WP_000537418.1.50278 WP_000537418.1.50304 WP_000537418.1.50345 WP_000537418.1.50353 WP_000537418.1.50358 WP_000537418.1.50366 WP_000537418.1.5037 WP_000537418.1.50380 WP_000537418.1.50381 WP_000537418.1.5040 WP_000537418.1.5041 WP_000537418.1.50412 WP_000537418.1.50418 WP_000537418.1.50446 WP_000537418.1.50452 WP_000537418.1.5046 WP_000537418.1.50548 WP_000537418.1.50549 WP_000537418.1.50564 WP_000537418.1.50579 WP_000537418.1.50586 WP_000537418.1.506 WP_000537418.1.5061 WP_000537418.1.50616 WP_000537418.1.5067 WP_000537418.1.50715 WP_000537418.1.50717 WP_000537418.1.50725 WP_000537418.1.50728 WP_000537418.1.50762 WP_000537418.1.50936 WP_000537418.1.50939 WP_000537418.1.50969 WP_000537418.1.50986 WP_000537418.1.50993 WP_000537418.1.50996 WP_000537418.1.51013 WP_000537418.1.51042 WP_000537418.1.5106 WP_000537418.1.51109 WP_000537418.1.51127 WP_000537418.1.51154 WP_000537418.1.51171 WP_000537418.1.51172 WP_000537418.1.51201 WP_000537418.1.51248 WP_000537418.1.51255 WP_000537418.1.51278 WP_000537418.1.5128 WP_000537418.1.51300 WP_000537418.1.51323 WP_000537418.1.51325 WP_000537418.1.51336 WP_000537418.1.51354 WP_000537418.1.51380 WP_000537418.1.51405 WP_000537418.1.51425 WP_000537418.1.51427 WP_000537418.1.51430 WP_000537418.1.51441 WP_000537418.1.5146 WP_000537418.1.51462 WP_000537418.1.51482 WP_000537418.1.51490 WP_000537418.1.51495 WP_000537418.1.51503 WP_000537418.1.51505 WP_000537418.1.51513 WP_000537418.1.51539 WP_000537418.1.51542 WP_000537418.1.51548 WP_000537418.1.51552 WP_000537418.1.5157 WP_000537418.1.51580 WP_000537418.1.51587 WP_000537418.1.51607 WP_000537418.1.51624 WP_000537418.1.51629 WP_000537418.1.51643 WP_000537418.1.51662 WP_000537418.1.51693 WP_000537418.1.51707 WP_000537418.1.51718 WP_000537418.1.5172 WP_000537418.1.51760 WP_000537418.1.51784 WP_000537418.1.51834 WP_000537418.1.51837 WP_000537418.1.51839 WP_000537418.1.51869 WP_000537418.1.51899 WP_000537418.1.51906 WP_000537418.1.51968 WP_000537418.1.51985 WP_000537418.1.51988 WP_000537418.1.51999 WP_000537418.1.52002 WP_000537418.1.52011 WP_000537418.1.52020 WP_000537418.1.52039 WP_000537418.1.52044 WP_000537418.1.52062 WP_000537418.1.52076 WP_000537418.1.52111 WP_000537418.1.52126 WP_000537418.1.52127 WP_000537418.1.52135 WP_000537418.1.5217 WP_000537418.1.52171 WP_000537418.1.52186 WP_000537418.1.52200 WP_000537418.1.52211 WP_000537418.1.52214 WP_000537418.1.52225 WP_000537418.1.52230 WP_000537418.1.52236 WP_000537418.1.52240 WP_000537418.1.52243 WP_000537418.1.5227 WP_000537418.1.52304 WP_000537418.1.52305 WP_000537418.1.52324 WP_000537418.1.52328 WP_000537418.1.52378 WP_000537418.1.5239 WP_000537418.1.52399 WP_000537418.1.52413 WP_000537418.1.52419 WP_000537418.1.52421 WP_000537418.1.52492 WP_000537418.1.52496 WP_000537418.1.52543 WP_000537418.1.52544 WP_000537418.1.52554 WP_000537418.1.52558 WP_000537418.1.52567 WP_000537418.1.52601 WP_000537418.1.52612 WP_000537418.1.5265 WP_000537418.1.52662 WP_000537418.1.52691 WP_000537418.1.52704 WP_000537418.1.52710 WP_000537418.1.5272 WP_000537418.1.52735 WP_000537418.1.52755 WP_000537418.1.52762 WP_000537418.1.52774 WP_000537418.1.52780 WP_000537418.1.52781 WP_000537418.1.52801 WP_000537418.1.52844 WP_000537418.1.52853 WP_000537418.1.52855 WP_000537418.1.52881 WP_000537418.1.52883 WP_000537418.1.52895 WP_000537418.1.52908 WP_000537418.1.52933 WP_000537418.1.52942 WP_000537418.1.52962 WP_000537418.1.52995 WP_000537418.1.52996 WP_000537418.1.53012 WP_000537418.1.53020 WP_000537418.1.53027 WP_000537418.1.53065 WP_000537418.1.53084 WP_000537418.1.53099 WP_000537418.1.5310 WP_000537418.1.53110 WP_000537418.1.53155 WP_000537418.1.53181 WP_000537418.1.53186 WP_000537418.1.532 WP_000537418.1.53211 WP_000537418.1.5322 WP_000537418.1.53223 WP_000537418.1.53228 WP_000537418.1.53238 WP_000537418.1.53242 WP_000537418.1.53244 WP_000537418.1.53252 WP_000537418.1.53262 WP_000537418.1.53270 WP_000537418.1.53277 WP_000537418.1.53308 WP_000537418.1.53327 WP_000537418.1.53356 WP_000537418.1.53364 WP_000537418.1.53377 WP_000537418.1.53401 WP_000537418.1.53419 WP_000537418.1.5342 WP_000537418.1.53428 WP_000537418.1.53431 WP_000537418.1.53482 WP_000537418.1.53505 WP_000537418.1.5351 WP_000537418.1.53535 WP_000537418.1.53545 WP_000537418.1.53574 WP_000537418.1.53582 WP_000537418.1.53590 WP_000537418.1.53592 WP_000537418.1.53594 WP_000537418.1.5362 WP_000537418.1.53642 WP_000537418.1.53645 WP_000537418.1.53706 WP_000537418.1.53769 WP_000537418.1.53809 WP_000537418.1.53811 WP_000537418.1.53841 WP_000537418.1.53863 WP_000537418.1.53866 WP_000537418.1.53878 WP_000537418.1.53884 WP_000537418.1.53931 WP_000537418.1.5395 WP_000537418.1.53966 WP_000537418.1.53968 WP_000537418.1.53972 WP_000537418.1.53994 WP_000537418.1.54002 WP_000537418.1.54013 WP_000537418.1.54023 WP_000537418.1.54024 WP_000537418.1.54072 WP_000537418.1.54169 WP_000537418.1.54185 WP_000537418.1.54213 WP_000537418.1.54263 WP_000537418.1.54307 WP_000537418.1.54317 WP_000537418.1.54329 WP_000537418.1.5433 WP_000537418.1.54344 WP_000537418.1.54359 WP_000537418.1.5440 WP_000537418.1.5441 WP_000537418.1.54454 WP_000537418.1.54476 WP_000537418.1.54507 WP_000537418.1.54546 WP_000537418.1.54591 WP_000537418.1.5460 WP_000537418.1.54602 WP_000537418.1.54605 WP_000537418.1.5461 WP_000537418.1.54614 WP_000537418.1.54617 WP_000537418.1.54620 WP_000537418.1.54625 WP_000537418.1.54638 WP_000537418.1.54641 WP_000537418.1.5467 WP_000537418.1.54688 WP_000537418.1.54695 WP_000537418.1.5470 WP_000537418.1.54725 WP_000537418.1.54729 WP_000537418.1.54769 WP_000537418.1.5479 WP_000537418.1.54798 WP_000537418.1.54829 WP_000537418.1.5486 WP_000537418.1.54883 WP_000537418.1.54918 WP_000537418.1.54921 WP_000537418.1.54927 WP_000537418.1.54941 WP_000537418.1.54946 WP_000537418.1.54972 WP_000537418.1.54981 WP_000537418.1.54991 WP_000537418.1.55005 WP_000537418.1.55009 WP_000537418.1.55041 WP_000537418.1.55115 WP_000537418.1.55123 WP_000537418.1.55134 WP_000537418.1.55177 WP_000537418.1.55185 WP_000537418.1.55197 WP_000537418.1.5520 WP_000537418.1.55203 WP_000537418.1.55218 WP_000537418.1.55222 WP_000537418.1.55286 WP_000537418.1.55291 WP_000537418.1.55338 WP_000537418.1.55342 WP_000537418.1.55357 WP_000537418.1.55359 WP_000537418.1.55374 WP_000537418.1.55381 WP_000537418.1.55417 WP_000537418.1.55425 WP_000537418.1.55466 WP_000537418.1.55483 WP_000537418.1.55489 WP_000537418.1.55492 WP_000537418.1.55507 WP_000537418.1.55529 WP_000537418.1.55551 WP_000537418.1.55552 WP_000537418.1.55556 WP_000537418.1.55560 WP_000537418.1.55571 WP_000537418.1.55574 WP_000537418.1.55581 WP_000537418.1.55597 WP_000537418.1.55608 WP_000537418.1.5561 WP_000537418.1.55629 WP_000537418.1.5566 WP_000537418.1.55676 WP_000537418.1.5570 WP_000537418.1.55709 WP_000537418.1.55720 WP_000537418.1.55727 WP_000537418.1.55730 WP_000537418.1.55787 WP_000537418.1.55820 WP_000537418.1.55825 WP_000537418.1.55838 WP_000537418.1.55844 WP_000537418.1.55868 WP_000537418.1.55870 WP_000537418.1.55892 WP_000537418.1.55897 WP_000537418.1.55979 WP_000537418.1.56072 WP_000537418.1.56101 WP_000537418.1.5614 WP_000537418.1.56149 WP_000537418.1.56151 WP_000537418.1.5616 WP_000537418.1.56164 WP_000537418.1.56177 WP_000537418.1.56193 WP_000537418.1.56197 WP_000537418.1.56216 WP_000537418.1.56231 WP_000537418.1.56285 WP_000537418.1.56345 WP_000537418.1.56371 WP_000537418.1.56388 WP_000537418.1.56392 WP_000537418.1.56399 WP_000537418.1.56436 WP_000537418.1.56439 WP_000537418.1.56446 WP_000537418.1.56481 WP_000537418.1.56489 WP_000537418.1.5649 WP_000537418.1.56491 WP_000537418.1.56513 WP_000537418.1.56528 WP_000537418.1.56543 WP_000537418.1.56554 WP_000537418.1.56571 WP_000537418.1.56573 WP_000537418.1.56665 WP_000537418.1.56680 WP_000537418.1.56689 WP_000537418.1.56704 WP_000537418.1.56713 WP_000537418.1.56776 WP_000537418.1.56777 WP_000537418.1.56786 WP_000537418.1.56787 WP_000537418.1.56799 WP_000537418.1.56846 WP_000537418.1.5685 WP_000537418.1.56871 WP_000537418.1.56882 WP_000537418.1.56908 WP_000537418.1.56932 WP_000537418.1.56934 WP_000537418.1.56937 WP_000537418.1.56951 WP_000537418.1.56978 WP_000537418.1.56992 WP_000537418.1.57032 WP_000537418.1.57051 WP_000537418.1.57068 WP_000537418.1.57071 WP_000537418.1.57072 WP_000537418.1.57086 WP_000537418.1.57100 WP_000537418.1.57124 WP_000537418.1.57180 WP_000537418.1.57181 WP_000537418.1.57185 WP_000537418.1.57197 WP_000537418.1.57216 WP_000537418.1.57222 WP_000537418.1.57254 WP_000537418.1.57269 WP_000537418.1.57280 WP_000537418.1.57281 WP_000537418.1.57319 WP_000537418.1.57349 WP_000537418.1.57386 WP_000537418.1.57401 WP_000537418.1.57403 WP_000537418.1.57410 WP_000537418.1.57414 WP_000537418.1.57432 WP_000537418.1.57453 WP_000537418.1.57466 WP_000537418.1.5748 WP_000537418.1.57487 WP_000537418.1.57517 WP_000537418.1.57538 WP_000537418.1.57558 WP_000537418.1.57574 WP_000537418.1.57588 WP_000537418.1.57610 WP_000537418.1.57628 WP_000537418.1.57629 WP_000537418.1.57634 WP_000537418.1.57638 WP_000537418.1.5764 WP_000537418.1.57646 WP_000537418.1.57659 WP_000537418.1.57663 WP_000537418.1.57669 WP_000537418.1.57719 WP_000537418.1.57738 WP_000537418.1.57812 WP_000537418.1.57836 WP_000537418.1.57846 WP_000537418.1.5786 WP_000537418.1.57898 WP_000537418.1.57903 WP_000537418.1.57904 WP_000537418.1.57920 WP_000537418.1.57951 WP_000537418.1.57975 WP_000537418.1.58001 WP_000537418.1.58045 WP_000537418.1.58048 WP_000537418.1.58057 WP_000537418.1.58060 WP_000537418.1.58080 WP_000537418.1.5812 WP_000537418.1.58128 WP_000537418.1.58143 WP_000537418.1.58163 WP_000537418.1.58169 WP_000537418.1.58206 WP_000537418.1.58226 WP_000537418.1.58232 WP_000537418.1.58238 WP_000537418.1.58267 WP_000537418.1.58289 WP_000537418.1.58316 WP_000537418.1.58336 WP_000537418.1.58368 WP_000537418.1.58371 WP_000537418.1.58384 WP_000537418.1.584 WP_000537418.1.58401 WP_000537418.1.58408 WP_000537418.1.5842 WP_000537418.1.58420 WP_000537418.1.58423 WP_000537418.1.58429 WP_000537418.1.58440 WP_000537418.1.58445 WP_000537418.1.58475 WP_000537418.1.58484 WP_000537418.1.58493 WP_000537418.1.58496 WP_000537418.1.58507 WP_000537418.1.58514 WP_000537418.1.5852 WP_000537418.1.58528 WP_000537418.1.58547 WP_000537418.1.58572 WP_000537418.1.58582 WP_000537418.1.58622 WP_000537418.1.58680 WP_000537418.1.58705 WP_000537418.1.58707 WP_000537418.1.58723 WP_000537418.1.58837 WP_000537418.1.58867 WP_000537418.1.58901 WP_000537418.1.58940 WP_000537418.1.58942 WP_000537418.1.58951 WP_000537418.1.58976 WP_000537418.1.58977 WP_000537418.1.58983 WP_000537418.1.59024 WP_000537418.1.59026 WP_000537418.1.59035 WP_000537418.1.59038 WP_000537418.1.59047 WP_000537418.1.5906 WP_000537418.1.59083 WP_000537418.1.59119 WP_000537418.1.59174 WP_000537418.1.59190 WP_000537418.1.59199 WP_000537418.1.59218 WP_000537418.1.59280 WP_000537418.1.59293 WP_000537418.1.59306 WP_000537418.1.59359 WP_000537418.1.59374 WP_000537418.1.59395 WP_000537418.1.59396 WP_000537418.1.59407 WP_000537418.1.59413 WP_000537418.1.59423 WP_000537418.1.59434 WP_000537418.1.59470 WP_000537418.1.59491 WP_000537418.1.59513 WP_000537418.1.59533 WP_000537418.1.59553 WP_000537418.1.59590 WP_000537418.1.59615 WP_000537418.1.59621 WP_000537418.1.59638 WP_000537418.1.5965 WP_000537418.1.59679 WP_000537418.1.59689 WP_000537418.1.59699 WP_000537418.1.597 WP_000537418.1.59717 WP_000537418.1.59730 WP_000537418.1.59733 WP_000537418.1.59737 WP_000537418.1.59756 WP_000537418.1.59781 WP_000537418.1.59782 WP_000537418.1.59791 WP_000537418.1.59823 WP_000537418.1.59836 WP_000537418.1.59838 WP_000537418.1.59853 WP_000537418.1.59855 WP_000537418.1.5990 WP_000537418.1.59905 WP_000537418.1.59912 WP_000537418.1.59914 WP_000537418.1.59931 WP_000537418.1.59932 WP_000537418.1.59959 WP_000537418.1.59998 WP_000537418.1.60005 WP_000537418.1.6002 WP_000537418.1.60023 WP_000537418.1.60031 WP_000537418.1.60042 WP_000537418.1.60043 WP_000537418.1.60067 WP_000537418.1.60070 WP_000537418.1.60095 WP_000537418.1.60117 WP_000537418.1.6013 WP_000537418.1.60186 WP_000537418.1.60225 WP_000537418.1.60228 WP_000537418.1.60246 WP_000537418.1.60304 WP_000537418.1.60325 WP_000537418.1.60374 WP_000537418.1.60387 WP_000537418.1.60436 WP_000537418.1.60443 WP_000537418.1.60457 WP_000537418.1.60461 WP_000537418.1.60477 WP_000537418.1.60491 WP_000537418.1.60498 WP_000537418.1.60505 WP_000537418.1.60550 WP_000537418.1.60559 WP_000537418.1.60570 WP_000537418.1.60599 WP_000537418.1.60606 WP_000537418.1.6061 WP_000537418.1.60613 WP_000537418.1.60614 WP_000537418.1.6064 WP_000537418.1.60644 WP_000537418.1.60647 WP_000537418.1.6066 WP_000537418.1.60671 WP_000537418.1.60684 WP_000537418.1.60698 WP_000537418.1.60717 WP_000537418.1.60732 WP_000537418.1.60744 WP_000537418.1.60761 WP_000537418.1.60764 WP_000537418.1.60771 WP_000537418.1.60805 WP_000537418.1.60816 WP_000537418.1.60826 WP_000537418.1.60832 WP_000537418.1.60847 WP_000537418.1.60872 WP_000537418.1.60895 WP_000537418.1.60901 WP_000537418.1.60921 WP_000537418.1.60925 WP_000537418.1.60927 WP_000537418.1.60935 WP_000537418.1.6094 WP_000537418.1.60974 WP_000537418.1.61005 WP_000537418.1.61008 WP_000537418.1.61035 WP_000537418.1.61039 WP_000537418.1.61046 WP_000537418.1.6106 WP_000537418.1.61096 WP_000537418.1.61099 WP_000537418.1.61102 WP_000537418.1.61108 WP_000537418.1.61148 WP_000537418.1.61170 WP_000537418.1.61174 WP_000537418.1.61175 WP_000537418.1.61183 WP_000537418.1.61186 WP_000537418.1.61223 WP_000537418.1.61225 WP_000537418.1.61241 WP_000537418.1.61253 WP_000537418.1.61268 WP_000537418.1.61292 WP_000537418.1.61362 WP_000537418.1.61373 WP_000537418.1.61496 WP_000537418.1.61505 WP_000537418.1.61517 WP_000537418.1.61524 WP_000537418.1.61551 WP_000537418.1.61608 WP_000537418.1.61612 WP_000537418.1.61623 WP_000537418.1.61636 WP_000537418.1.61643 WP_000537418.1.61663 WP_000537418.1.61703 WP_000537418.1.61718 WP_000537418.1.61758 WP_000537418.1.61772 WP_000537418.1.61779 WP_000537418.1.618 WP_000537418.1.61806 WP_000537418.1.61822 WP_000537418.1.61853 WP_000537418.1.61858 WP_000537418.1.61874 WP_000537418.1.61893 WP_000537418.1.61926 WP_000537418.1.61939 WP_000537418.1.61948 WP_000537418.1.61949 WP_000537418.1.61955 WP_000537418.1.61966 WP_000537418.1.62041 WP_000537418.1.62099 WP_000537418.1.6212 WP_000537418.1.62135 WP_000537418.1.62157 WP_000537418.1.62182 WP_000537418.1.62207 WP_000537418.1.62264 WP_000537418.1.62273 WP_000537418.1.62282 WP_000537418.1.62290 WP_000537418.1.62296 WP_000537418.1.62303 WP_000537418.1.62337 WP_000537418.1.62348 WP_000537418.1.62358 WP_000537418.1.62447 WP_000537418.1.6245 WP_000537418.1.62460 WP_000537418.1.62480 WP_000537418.1.62487 WP_000537418.1.62503 WP_000537418.1.62507 WP_000537418.1.62513 WP_000537418.1.6261 WP_000537418.1.62612 WP_000537418.1.62642 WP_000537418.1.62646 WP_000537418.1.62668 WP_000537418.1.62675 WP_000537418.1.62681 WP_000537418.1.62735 WP_000537418.1.62750 WP_000537418.1.62762 WP_000537418.1.62769 WP_000537418.1.62787 WP_000537418.1.62802 WP_000537418.1.62812 WP_000537418.1.62818 WP_000537418.1.62840 WP_000537418.1.62843 WP_000537418.1.62850 WP_000537418.1.62888 WP_000537418.1.62914 WP_000537418.1.6293 WP_000537418.1.62931 WP_000537418.1.62959 WP_000537418.1.62973 WP_000537418.1.62989 WP_000537418.1.62992 WP_000537418.1.63023 WP_000537418.1.63078 WP_000537418.1.63167 WP_000537418.1.63189 WP_000537418.1.6323 WP_000537418.1.63246 WP_000537418.1.63287 WP_000537418.1.6331 WP_000537418.1.6334 WP_000537418.1.6337 WP_000537418.1.63370 WP_000537418.1.63374 WP_000537418.1.63393 WP_000537418.1.63435 WP_000537418.1.63445 WP_000537418.1.63453 WP_000537418.1.63466 WP_000537418.1.63467 WP_000537418.1.63470 WP_000537418.1.63478 WP_000537418.1.6348 WP_000537418.1.63484 WP_000537418.1.63491 WP_000537418.1.63536 WP_000537418.1.63556 WP_000537418.1.63563 WP_000537418.1.63576 WP_000537418.1.63586 WP_000537418.1.63602 WP_000537418.1.63615 WP_000537418.1.6364 WP_000537418.1.63666 WP_000537418.1.63683 WP_000537418.1.63703 WP_000537418.1.63746 WP_000537418.1.63800 WP_000537418.1.63821 WP_000537418.1.63871 WP_000537418.1.63872 WP_000537418.1.63957 WP_000537418.1.63964 WP_000537418.1.63990 WP_000537418.1.64008 WP_000537418.1.64014 WP_000537418.1.64040 WP_000537418.1.64080 WP_000537418.1.64086 WP_000537418.1.64110 WP_000537418.1.6416 WP_000537418.1.64161 WP_000537418.1.64175 WP_000537418.1.64193 WP_000537418.1.64280 WP_000537418.1.64285 WP_000537418.1.64286 WP_000537418.1.6431 WP_000537418.1.64321 WP_000537418.1.64337 WP_000537418.1.64353 WP_000537418.1.64371 WP_000537418.1.64380 WP_000537418.1.64391 WP_000537418.1.6441 WP_000537418.1.64437 WP_000537418.1.64438 WP_000537418.1.6445 WP_000537418.1.64458 WP_000537418.1.64519 WP_000537418.1.64528 WP_000537418.1.64540 WP_000537418.1.64563 WP_000537418.1.64621 WP_000537418.1.64634 WP_000537418.1.64657 WP_000537418.1.6469 WP_000537418.1.64693 WP_000537418.1.647 WP_000537418.1.64707 WP_000537418.1.64746 WP_000537418.1.64749 WP_000537418.1.64784 WP_000537418.1.64789 WP_000537418.1.64821 WP_000537418.1.64866 WP_000537418.1.64881 WP_000537418.1.64895 WP_000537418.1.64912 WP_000537418.1.64939 WP_000537418.1.64946 WP_000537418.1.64970 WP_000537418.1.64990 WP_000537418.1.65023 WP_000537418.1.65035 WP_000537418.1.65040 WP_000537418.1.65056 WP_000537418.1.65084 WP_000537418.1.651 WP_000537418.1.6511 WP_000537418.1.65110 WP_000537418.1.65118 WP_000537418.1.65135 WP_000537418.1.65151 WP_000537418.1.65155 WP_000537418.1.6516 WP_000537418.1.65179 WP_000537418.1.65192 WP_000537418.1.65194 WP_000537418.1.65206 WP_000537418.1.65256 WP_000537418.1.65271 WP_000537418.1.65296 WP_000537418.1.65305 WP_000537418.1.65306 WP_000537418.1.65353 WP_000537418.1.65364 WP_000537418.1.6537 WP_000537418.1.65370 WP_000537418.1.65372 WP_000537418.1.654 WP_000537418.1.65408 WP_000537418.1.65413 WP_000537418.1.65415 WP_000537418.1.65493 WP_000537418.1.6553 WP_000537418.1.65531 WP_000537418.1.65546 WP_000537418.1.65581 WP_000537418.1.65596 WP_000537418.1.6563 WP_000537418.1.65667 WP_000537418.1.65672 WP_000537418.1.65677 WP_000537418.1.65708 WP_000537418.1.65714 WP_000537418.1.65762 WP_000537418.1.6587 WP_000537418.1.65875 WP_000537418.1.65898 WP_000537418.1.65912 WP_000537418.1.65954 WP_000537418.1.65961 WP_000537418.1.65963 WP_000537418.1.65978 WP_000537418.1.65988 WP_000537418.1.66001 WP_000537418.1.66007 WP_000537418.1.66033 WP_000537418.1.6604 WP_000537418.1.66050 WP_000537418.1.66100 WP_000537418.1.66102 WP_000537418.1.66104 WP_000537418.1.66105 WP_000537418.1.66121 WP_000537418.1.66127 WP_000537418.1.66161 WP_000537418.1.66181 WP_000537418.1.66187 WP_000537418.1.66197 WP_000537418.1.6622 WP_000537418.1.66251 WP_000537418.1.66264 WP_000537418.1.66327 WP_000537418.1.66335 WP_000537418.1.6635 WP_000537418.1.66387 WP_000537418.1.66389 WP_000537418.1.66395 WP_000537418.1.66412 WP_000537418.1.66432 WP_000537418.1.6645 WP_000537418.1.66501 WP_000537418.1.66531 WP_000537418.1.6654 WP_000537418.1.66550 WP_000537418.1.66559 WP_000537418.1.66566 WP_000537418.1.66579 WP_000537418.1.66624 WP_000537418.1.66644 WP_000537418.1.6665 WP_000537418.1.66700 WP_000537418.1.66719 WP_000537418.1.66758 WP_000537418.1.66783 WP_000537418.1.66791 WP_000537418.1.66795 WP_000537418.1.66849 WP_000537418.1.66873 WP_000537418.1.66922 WP_000537418.1.66926 WP_000537418.1.66933 WP_000537418.1.66948 WP_000537418.1.66975 WP_000537418.1.67021 WP_000537418.1.67022 WP_000537418.1.67073 WP_000537418.1.67116 WP_000537418.1.67120 WP_000537418.1.67136 WP_000537418.1.67137 WP_000537418.1.67149 WP_000537418.1.67150 WP_000537418.1.67193 WP_000537418.1.67194 WP_000537418.1.67200 WP_000537418.1.67214 WP_000537418.1.6723 WP_000537418.1.67278 WP_000537418.1.67293 WP_000537418.1.6735 WP_000537418.1.67383 WP_000537418.1.67415 WP_000537418.1.67446 WP_000537418.1.67454 WP_000537418.1.67462 WP_000537418.1.67467 WP_000537418.1.67468 WP_000537418.1.67522 WP_000537418.1.67533 WP_000537418.1.67538 WP_000537418.1.67549 WP_000537418.1.67553 WP_000537418.1.67581 WP_000537418.1.67660 WP_000537418.1.67663 WP_000537418.1.67676 WP_000537418.1.6769 WP_000537418.1.67701 WP_000537418.1.67704 WP_000537418.1.67724 WP_000537418.1.67726 WP_000537418.1.67732 WP_000537418.1.67753 WP_000537418.1.67775 WP_000537418.1.67780 WP_000537418.1.67786 WP_000537418.1.67787 WP_000537418.1.67788 WP_000537418.1.678 WP_000537418.1.67841 WP_000537418.1.67853 WP_000537418.1.67861 WP_000537418.1.67901 WP_000537418.1.67938 WP_000537418.1.67975 WP_000537418.1.67984 WP_000537418.1.67990 WP_000537418.1.68008 WP_000537418.1.6802 WP_000537418.1.68025 WP_000537418.1.6803 WP_000537418.1.68039 WP_000537418.1.68053 WP_000537418.1.68067 WP_000537418.1.68069 WP_000537418.1.68079 WP_000537418.1.68096 WP_000537418.1.68108 WP_000537418.1.68126 WP_000537418.1.6814 WP_000537418.1.68145 WP_000537418.1.68170 WP_000537418.1.68175 WP_000537418.1.682 WP_000537418.1.68215 WP_000537418.1.68241 WP_000537418.1.68255 WP_000537418.1.68271 WP_000537418.1.68278 WP_000537418.1.68281 WP_000537418.1.68283 WP_000537418.1.68336 WP_000537418.1.68341 WP_000537418.1.68347 WP_000537418.1.68369 WP_000537418.1.68396 WP_000537418.1.68411 WP_000537418.1.68442 WP_000537418.1.68482 WP_000537418.1.68490 WP_000537418.1.68493 WP_000537418.1.68523 WP_000537418.1.68534 WP_000537418.1.68566 WP_000537418.1.68584 WP_000537418.1.68598 WP_000537418.1.68609 WP_000537418.1.68630 WP_000537418.1.68635 WP_000537418.1.68673 WP_000537418.1.68678 WP_000537418.1.68679 WP_000537418.1.68697 WP_000537418.1.68711 WP_000537418.1.68750 WP_000537418.1.68751 WP_000537418.1.68752 WP_000537418.1.6877 WP_000537418.1.68797 WP_000537418.1.6880 WP_000537418.1.68801 WP_000537418.1.68865 WP_000537418.1.6887 WP_000537418.1.68880 WP_000537418.1.68936 WP_000537418.1.68956 WP_000537418.1.68961 WP_000537418.1.68989 WP_000537418.1.69039 WP_000537418.1.69054 WP_000537418.1.69098 WP_000537418.1.69126 WP_000537418.1.69144 WP_000537418.1.6916 WP_000537418.1.6919 WP_000537418.1.69192 WP_000537418.1.69247 WP_000537418.1.69258 WP_000537418.1.69261 WP_000537418.1.6929 WP_000537418.1.69303 WP_000537418.1.69305 WP_000537418.1.69350 WP_000537418.1.69351 WP_000537418.1.69390 WP_000537418.1.694 WP_000537418.1.69441 WP_000537418.1.6945 WP_000537418.1.69472 WP_000537418.1.69473 WP_000537418.1.69537 WP_000537418.1.69551 WP_000537418.1.69583 WP_000537418.1.69589 WP_000537418.1.69593 WP_000537418.1.69605 WP_000537418.1.69646 WP_000537418.1.69655 WP_000537418.1.69689 WP_000537418.1.69730 WP_000537418.1.69780 WP_000537418.1.69786 WP_000537418.1.69803 WP_000537418.1.69810 WP_000537418.1.69818 WP_000537418.1.69887 WP_000537418.1.69896 WP_000537418.1.6993 WP_000537418.1.69972 WP_000537418.1.69979 WP_000537418.1.70063 WP_000537418.1.70081 WP_000537418.1.70123 WP_000537418.1.70125 WP_000537418.1.7013 WP_000537418.1.70149 WP_000537418.1.70190 WP_000537418.1.70213 WP_000537418.1.70256 WP_000537418.1.70357 WP_000537418.1.70407 WP_000537418.1.70414 WP_000537418.1.70492 WP_000537418.1.70509 WP_000537418.1.70517 WP_000537418.1.70530 WP_000537418.1.70539 WP_000537418.1.70576 WP_000537418.1.70578 WP_000537418.1.70592 WP_000537418.1.70600 WP_000537418.1.70619 WP_000537418.1.70628 WP_000537418.1.70656 WP_000537418.1.70694 WP_000537418.1.70698 WP_000537418.1.70713 WP_000537418.1.70723 WP_000537418.1.70728 WP_000537418.1.70745 WP_000537418.1.70747 WP_000537418.1.70748 WP_000537418.1.70767 WP_000537418.1.70787 WP_000537418.1.70794 WP_000537418.1.70803 WP_000537418.1.70880 WP_000537418.1.7090 WP_000537418.1.70900 WP_000537418.1.70952 WP_000537418.1.70967 WP_000537418.1.71003 WP_000537418.1.71024 WP_000537418.1.71037 WP_000537418.1.71042 WP_000537418.1.71062 WP_000537418.1.71099 WP_000537418.1.71109 WP_000537418.1.71113 WP_000537418.1.71147 WP_000537418.1.71159 WP_000537418.1.71162 WP_000537418.1.71170 WP_000537418.1.71176 WP_000537418.1.71192 WP_000537418.1.71199 WP_000537418.1.71205 WP_000537418.1.71221 WP_000537418.1.71223 WP_000537418.1.71225 WP_000537418.1.71226 WP_000537418.1.71229 WP_000537418.1.71264 WP_000537418.1.71269 WP_000537418.1.71272 WP_000537418.1.71273 WP_000537418.1.71312 WP_000537418.1.71315 WP_000537418.1.71323 WP_000537418.1.71339 WP_000537418.1.71354 WP_000537418.1.71403 WP_000537418.1.71409 WP_000537418.1.71423 WP_000537418.1.71448 WP_000537418.1.7147 WP_000537418.1.71480 WP_000537418.1.71522 WP_000537418.1.71533 WP_000537418.1.71537 WP_000537418.1.71540 WP_000537418.1.71560 WP_000537418.1.71603 WP_000537418.1.71632 WP_000537418.1.71680 WP_000537418.1.71690 WP_000537418.1.71757 WP_000537418.1.71767 WP_000537418.1.71783 WP_000537418.1.71832 WP_000537418.1.71837 WP_000537418.1.71840 WP_000537418.1.71856 WP_000537418.1.71874 WP_000537418.1.7192 WP_000537418.1.71922 WP_000537418.1.71940 WP_000537418.1.71944 WP_000537418.1.71945 WP_000537418.1.71975 WP_000537418.1.71993 WP_000537418.1.72013 WP_000537418.1.72016 WP_000537418.1.72021 WP_000537418.1.72033 WP_000537418.1.72053 WP_000537418.1.72054 WP_000537418.1.72090 WP_000537418.1.7210 WP_000537418.1.72120 WP_000537418.1.72125 WP_000537418.1.72126 WP_000537418.1.72141 WP_000537418.1.72153 WP_000537418.1.72155 WP_000537418.1.72157 WP_000537418.1.72180 WP_000537418.1.72184 WP_000537418.1.72237 WP_000537418.1.7225 WP_000537418.1.72261 WP_000537418.1.72262 WP_000537418.1.72270 WP_000537418.1.72279 WP_000537418.1.72293 WP_000537418.1.72322 WP_000537418.1.72337 WP_000537418.1.72362 WP_000537418.1.72391 WP_000537418.1.72392 WP_000537418.1.72397 WP_000537418.1.72414 WP_000537418.1.72427 WP_000537418.1.72431 WP_000537418.1.72485 WP_000537418.1.72493 WP_000537418.1.72511 WP_000537418.1.72521 WP_000537418.1.72522 WP_000537418.1.72535 WP_000537418.1.72537 WP_000537418.1.72574 WP_000537418.1.72593 WP_000537418.1.72606 WP_000537418.1.72608 WP_000537418.1.72614 WP_000537418.1.72615 WP_000537418.1.72616 WP_000537418.1.72641 WP_000537418.1.72643 WP_000537418.1.72651 WP_000537418.1.72652 WP_000537418.1.72694 WP_000537418.1.72725 WP_000537418.1.72729 WP_000537418.1.72738 WP_000537418.1.72745 WP_000537418.1.72747 WP_000537418.1.72751 WP_000537418.1.72758 WP_000537418.1.72764 WP_000537418.1.72778 WP_000537418.1.72804 WP_000537418.1.72806 WP_000537418.1.72837 WP_000537418.1.72860 WP_000537418.1.72869 WP_000537418.1.7291 WP_000537418.1.72910 WP_000537418.1.72913 WP_000537418.1.72947 WP_000537418.1.72956 WP_000537418.1.72998 WP_000537418.1.73000 WP_000537418.1.73010 WP_000537418.1.73015 WP_000537418.1.73072 WP_000537418.1.73075 WP_000537418.1.73085 WP_000537418.1.73126 WP_000537418.1.73129 WP_000537418.1.73193 WP_000537418.1.73197 WP_000537418.1.73217 WP_000537418.1.73239 WP_000537418.1.73243 WP_000537418.1.73249 WP_000537418.1.73251 WP_000537418.1.73257 WP_000537418.1.73259 WP_000537418.1.73278 WP_000537418.1.73292 WP_000537418.1.73295 WP_000537418.1.73326 WP_000537418.1.73340 WP_000537418.1.73343 WP_000537418.1.73349 WP_000537418.1.73385 WP_000537418.1.73393 WP_000537418.1.73428 WP_000537418.1.73468 WP_000537418.1.7349 WP_000537418.1.73498 WP_000537418.1.73524 WP_000537418.1.73565 WP_000537418.1.73592 WP_000537418.1.73604 WP_000537418.1.73626 WP_000537418.1.73631 WP_000537418.1.73652 WP_000537418.1.73663 WP_000537418.1.73700 WP_000537418.1.73717 WP_000537418.1.7376 WP_000537418.1.73785 WP_000537418.1.73801 WP_000537418.1.73807 WP_000537418.1.73811 WP_000537418.1.73835 WP_000537418.1.73844 WP_000537418.1.73859 WP_000537418.1.73882 WP_000537418.1.73897 WP_000537418.1.73908 WP_000537418.1.7392 WP_000537418.1.73934 WP_000537418.1.73942 WP_000537418.1.73968 WP_000537418.1.73980 WP_000537418.1.73992 WP_000537418.1.73995 WP_000537418.1.73996 WP_000537418.1.74051 WP_000537418.1.74053 WP_000537418.1.7411 WP_000537418.1.74123 WP_000537418.1.74156 WP_000537418.1.74184 WP_000537418.1.74213 WP_000537418.1.74223 WP_000537418.1.7424 WP_000537418.1.74243 WP_000537418.1.7425 WP_000537418.1.74251 WP_000537418.1.7429 WP_000537418.1.74294 WP_000537418.1.74309 WP_000537418.1.74365 WP_000537418.1.74423 WP_000537418.1.74444 WP_000537418.1.74445 WP_000537418.1.7446 WP_000537418.1.74465 WP_000537418.1.74478 WP_000537418.1.74491 WP_000537418.1.74501 WP_000537418.1.74513 WP_000537418.1.74520 WP_000537418.1.74521 WP_000537418.1.74528 WP_000537418.1.74532 WP_000537418.1.74536 WP_000537418.1.74557 WP_000537418.1.7461 WP_000537418.1.74624 WP_000537418.1.74625 WP_000537418.1.74652 WP_000537418.1.74670 WP_000537418.1.74687 WP_000537418.1.74688 WP_000537418.1.74689 WP_000537418.1.74691 WP_000537418.1.74705 WP_000537418.1.7471 WP_000537418.1.74713 WP_000537418.1.74716 WP_000537418.1.74735 WP_000537418.1.7475 WP_000537418.1.7479 WP_000537418.1.74793 WP_000537418.1.74811 WP_000537418.1.74828 WP_000537418.1.74844 WP_000537418.1.74852 WP_000537418.1.74854 WP_000537418.1.74867 WP_000537418.1.74873 WP_000537418.1.74879 WP_000537418.1.74885 WP_000537418.1.74895 WP_000537418.1.74904 WP_000537418.1.74914 WP_000537418.1.74962 WP_000537418.1.74975 WP_000537418.1.74993 WP_000537418.1.74998 WP_000537418.1.75021 WP_000537418.1.75029 WP_000537418.1.75030 WP_000537418.1.75050 WP_000537418.1.75112 WP_000537418.1.75138 WP_000537418.1.75139 WP_000537418.1.75143 WP_000537418.1.75145 WP_000537418.1.75149 WP_000537418.1.75155 WP_000537418.1.75164 WP_000537418.1.75181 WP_000537418.1.75209 WP_000537418.1.75219 WP_000537418.1.75221 WP_000537418.1.75243 WP_000537418.1.75247 WP_000537418.1.75248 WP_000537418.1.75254 WP_000537418.1.75272 WP_000537418.1.7536 WP_000537418.1.75360 WP_000537418.1.75367 WP_000537418.1.75382 WP_000537418.1.7539 WP_000537418.1.75428 WP_000537418.1.75435 WP_000537418.1.75465 WP_000537418.1.75491 WP_000537418.1.75507 WP_000537418.1.75515 WP_000537418.1.75529 WP_000537418.1.75536 WP_000537418.1.75537 WP_000537418.1.75568 WP_000537418.1.75577 WP_000537418.1.75594 WP_000537418.1.75602 WP_000537418.1.75612 WP_000537418.1.75629 WP_000537418.1.75644 WP_000537418.1.75653 WP_000537418.1.75672 WP_000537418.1.75676 WP_000537418.1.75679 WP_000537418.1.75687 WP_000537418.1.75694 WP_000537418.1.75698 WP_000537418.1.75699 WP_000537418.1.75758 WP_000537418.1.75767 WP_000537418.1.75803 WP_000537418.1.7583 WP_000537418.1.75983 WP_000537418.1.75989 WP_000537418.1.75995 WP_000537418.1.75999 WP_000537418.1.76005 WP_000537418.1.76009 WP_000537418.1.7603 WP_000537418.1.76036 WP_000537418.1.76039 WP_000537418.1.76054 WP_000537418.1.7608 WP_000537418.1.76087 WP_000537418.1.76089 WP_000537418.1.76103 WP_000537418.1.76118 WP_000537418.1.76119 WP_000537418.1.76129 WP_000537418.1.76152 WP_000537418.1.76184 WP_000537418.1.76189 WP_000537418.1.76196 WP_000537418.1.76211 WP_000537418.1.76312 WP_000537418.1.76325 WP_000537418.1.76361 WP_000537418.1.7637 WP_000537418.1.76384 WP_000537418.1.76387 WP_000537418.1.76390 WP_000537418.1.76407 WP_000537418.1.76446 WP_000537418.1.76448 WP_000537418.1.76452 WP_000537418.1.76462 WP_000537418.1.76466 WP_000537418.1.76477 WP_000537418.1.76544 WP_000537418.1.76547 WP_000537418.1.76562 WP_000537418.1.76595 WP_000537418.1.7661 WP_000537418.1.76612 WP_000537418.1.76619 WP_000537418.1.76656 WP_000537418.1.76697 WP_000537418.1.76701 WP_000537418.1.76705 WP_000537418.1.76707 WP_000537418.1.76712 WP_000537418.1.76815 WP_000537418.1.76827 WP_000537418.1.76840 WP_000537418.1.76884 WP_000537418.1.76909 WP_000537418.1.76918 WP_000537418.1.76933 WP_000537418.1.76948 WP_000537418.1.76965 WP_000537418.1.76966 WP_000537418.1.7699 WP_000537418.1.77015 WP_000537418.1.77070 WP_000537418.1.77099 WP_000537418.1.77120 WP_000537418.1.77128 WP_000537418.1.77147 WP_000537418.1.77162 WP_000537418.1.77163 WP_000537418.1.77214 WP_000537418.1.77239 WP_000537418.1.77255 WP_000537418.1.77258 WP_000537418.1.77275 WP_000537418.1.7728 WP_000537418.1.77284 WP_000537418.1.77288 WP_000537418.1.7731 WP_000537418.1.77326 WP_000537418.1.77341 WP_000537418.1.77358 WP_000537418.1.77391 WP_000537418.1.77392 WP_000537418.1.77437 WP_000537418.1.77448 WP_000537418.1.77452 WP_000537418.1.77462 WP_000537418.1.77470 WP_000537418.1.77471 WP_000537418.1.77477 WP_000537418.1.77495 WP_000537418.1.775 WP_000537418.1.77503 WP_000537418.1.77542 WP_000537418.1.77551 WP_000537418.1.77581 WP_000537418.1.77595 WP_000537418.1.77600 WP_000537418.1.77608 WP_000537418.1.77626 WP_000537418.1.77636 WP_000537418.1.77644 WP_000537418.1.77648 WP_000537418.1.77707 WP_000537418.1.77725 WP_000537418.1.77741 WP_000537418.1.77760 WP_000537418.1.77767 WP_000537418.1.77768 WP_000537418.1.7781 WP_000537418.1.77826 WP_000537418.1.77833 WP_000537418.1.77876 WP_000537418.1.77929 WP_000537418.1.77949 WP_000537418.1.7795 WP_000537418.1.77961 WP_000537418.1.77979 WP_000537418.1.7799 WP_000537418.1.77999 WP_000537418.1.78000 WP_000537418.1.78007 WP_000537418.1.78059 WP_000537418.1.7806 WP_000537418.1.78063 WP_000537418.1.7808 WP_000537418.1.78089 WP_000537418.1.78097 WP_000537418.1.78099 WP_000537418.1.78101 WP_000537418.1.78102 WP_000537418.1.78196 WP_000537418.1.78321 WP_000537418.1.78323 WP_000537418.1.78337 WP_000537418.1.78340 WP_000537418.1.78390 WP_000537418.1.784 WP_000537418.1.78413 WP_000537418.1.78445 WP_000537418.1.7847 WP_000537418.1.78481 WP_000537418.1.7851 WP_000537418.1.78515 WP_000537418.1.7855 WP_000537418.1.78553 WP_000537418.1.78583 WP_000537418.1.78593 WP_000537418.1.78610 WP_000537418.1.78611 WP_000537418.1.78612 WP_000537418.1.78615 WP_000537418.1.78645 WP_000537418.1.78683 WP_000537418.1.78687 WP_000537418.1.78696 WP_000537418.1.78718 WP_000537418.1.78746 WP_000537418.1.78750 WP_000537418.1.78775 WP_000537418.1.78791 WP_000537418.1.7883 WP_000537418.1.78843 WP_000537418.1.78854 WP_000537418.1.78891 WP_000537418.1.78919 WP_000537418.1.78953 WP_000537418.1.7896 WP_000537418.1.78966 WP_000537418.1.7898 WP_000537418.1.78996 WP_000537418.1.79002 WP_000537418.1.79004 WP_000537418.1.7901 WP_000537418.1.79065 WP_000537418.1.79067 WP_000537418.1.79075 WP_000537418.1.79086 WP_000537418.1.79088 WP_000537418.1.79090 WP_000537418.1.79092 WP_000537418.1.79159 WP_000537418.1.79172 WP_000537418.1.79226 WP_000537418.1.79246 WP_000537418.1.79248 WP_000537418.1.79249 WP_000537418.1.79306 WP_000537418.1.79308 WP_000537418.1.79312 WP_000537418.1.79346 WP_000537418.1.79356 WP_000537418.1.7937 WP_000537418.1.79391 WP_000537418.1.7940 WP_000537418.1.79416 WP_000537418.1.79478 WP_000537418.1.79505 WP_000537418.1.79519 WP_000537418.1.79525 WP_000537418.1.79526 WP_000537418.1.79528 WP_000537418.1.79540 WP_000537418.1.79558 WP_000537418.1.79563 WP_000537418.1.79576 WP_000537418.1.79591 WP_000537418.1.79685 WP_000537418.1.79713 WP_000537418.1.79715 WP_000537418.1.79764 WP_000537418.1.79800 WP_000537418.1.79816 WP_000537418.1.79824 WP_000537418.1.79840 WP_000537418.1.7985 WP_000537418.1.79869 WP_000537418.1.7987 WP_000537418.1.79871 WP_000537418.1.79877 WP_000537418.1.79905 WP_000537418.1.7993 WP_000537418.1.79930 WP_000537418.1.79931 WP_000537418.1.79932 WP_000537418.1.79936 WP_000537418.1.79944 WP_000537418.1.79952 WP_000537418.1.79965 WP_000537418.1.79984 WP_000537418.1.80011 WP_000537418.1.80043 WP_000537418.1.80050 WP_000537418.1.80060 WP_000537418.1.8007 WP_000537418.1.80071 WP_000537418.1.80106 WP_000537418.1.80112 WP_000537418.1.80136 WP_000537418.1.80141 WP_000537418.1.80176 WP_000537418.1.80192 WP_000537418.1.80255 WP_000537418.1.80292 WP_000537418.1.80309 WP_000537418.1.80310 WP_000537418.1.80320 WP_000537418.1.80330 WP_000537418.1.80388 WP_000537418.1.80426 WP_000537418.1.80428 WP_000537418.1.80440 WP_000537418.1.80444 WP_000537418.1.80456 WP_000537418.1.80484 WP_000537418.1.80517 WP_000537418.1.80519 WP_000537418.1.80524 WP_000537418.1.80545 WP_000537418.1.8057 WP_000537418.1.80578 WP_000537418.1.80594 WP_000537418.1.80606 WP_000537418.1.80612 WP_000537418.1.80626 WP_000537418.1.80662 WP_000537418.1.80666 WP_000537418.1.80676 WP_000537418.1.80709 WP_000537418.1.80731 WP_000537418.1.80736 WP_000537418.1.80737 WP_000537418.1.8074 WP_000537418.1.80754 WP_000537418.1.80756 WP_000537418.1.8076 WP_000537418.1.80768 WP_000537418.1.80789 WP_000537418.1.808 WP_000537418.1.80804 WP_000537418.1.80805 WP_000537418.1.80843 WP_000537418.1.80882 WP_000537418.1.80884 WP_000537418.1.80894 WP_000537418.1.8090 WP_000537418.1.8091 WP_000537418.1.80945 WP_000537418.1.80946 WP_000537418.1.80954 WP_000537418.1.80985 WP_000537418.1.810 WP_000537418.1.81026 WP_000537418.1.81034 WP_000537418.1.81036 WP_000537418.1.81070 WP_000537418.1.81071 WP_000537418.1.811 WP_000537418.1.81104 WP_000537418.1.81127 WP_000537418.1.81160 WP_000537418.1.81165 WP_000537418.1.8118 WP_000537418.1.81180 WP_000537418.1.81182 WP_000537418.1.8121 WP_000537418.1.81273 WP_000537418.1.81281 WP_000537418.1.81286 WP_000537418.1.8129 WP_000537418.1.81298 WP_000537418.1.81313 WP_000537418.1.81316 WP_000537418.1.81376 WP_000537418.1.81391 WP_000537418.1.81420 WP_000537418.1.81438 WP_000537418.1.81442 WP_000537418.1.81469 WP_000537418.1.81475 WP_000537418.1.81484 WP_000537418.1.81514 WP_000537418.1.81517 WP_000537418.1.8156 WP_000537418.1.81576 WP_000537418.1.81577 WP_000537418.1.81580 WP_000537418.1.81589 WP_000537418.1.81596 WP_000537418.1.81602 WP_000537418.1.81618 WP_000537418.1.81688 WP_000537418.1.81692 WP_000537418.1.81715 WP_000537418.1.81723 WP_000537418.1.81754 WP_000537418.1.81806 WP_000537418.1.81819 WP_000537418.1.81821 WP_000537418.1.81832 WP_000537418.1.81869 WP_000537418.1.81873 WP_000537418.1.81881 WP_000537418.1.81914 WP_000537418.1.81934 WP_000537418.1.81939 WP_000537418.1.81952 WP_000537418.1.81975 WP_000537418.1.82 WP_000537418.1.82010 WP_000537418.1.82032 WP_000537418.1.82057 WP_000537418.1.82059 WP_000537418.1.82061 WP_000537418.1.82062 WP_000537418.1.82074 WP_000537418.1.82095 WP_000537418.1.82116 WP_000537418.1.82239 WP_000537418.1.82240 WP_000537418.1.82246 WP_000537418.1.82275 WP_000537418.1.82280 WP_000537418.1.82296 WP_000537418.1.82316 WP_000537418.1.82320 WP_000537418.1.82326 WP_000537418.1.82330 WP_000537418.1.8235 WP_000537418.1.82438 WP_000537418.1.82439 WP_000537418.1.82499 WP_000537418.1.82514 WP_000537418.1.82536 WP_000537418.1.82572 WP_000537418.1.82594 WP_000537418.1.82614 WP_000537418.1.82626 WP_000537418.1.82629 WP_000537418.1.82647 WP_000537418.1.8268 WP_000537418.1.82700 WP_000537418.1.82705 WP_000537418.1.82711 WP_000537418.1.82715 WP_000537418.1.8277 WP_000537418.1.82780 WP_000537418.1.82797 WP_000537418.1.82799 WP_000537418.1.82820 WP_000537418.1.82831 WP_000537418.1.82853 WP_000537418.1.82902 WP_000537418.1.83020 WP_000537418.1.83033 WP_000537418.1.83035 WP_000537418.1.83051 WP_000537418.1.8306 WP_000537418.1.8308 WP_000537418.1.83097 WP_000537418.1.83099 WP_000537418.1.831 WP_000537418.1.83140 WP_000537418.1.83144 WP_000537418.1.83160 WP_000537418.1.83177 WP_000537418.1.83205 WP_000537418.1.83224 WP_000537418.1.83330 WP_000537418.1.83347 WP_000537418.1.8345 WP_000537418.1.83466 WP_000537418.1.83481 WP_000537418.1.83537 WP_000537418.1.83564 WP_000537418.1.83584 WP_000537418.1.83684 WP_000537418.1.83712 WP_000537418.1.83735 WP_000537418.1.83762 WP_000537418.1.83781 WP_000537418.1.83807 WP_000537418.1.83820 WP_000537418.1.83941 WP_000537418.1.83947 WP_000537418.1.84004 WP_000537418.1.84060 WP_000537418.1.84074 WP_000537418.1.8411 WP_000537418.1.84140 WP_000537418.1.84172 WP_000537418.1.84185 WP_000537418.1.84210 WP_000537418.1.84219 WP_000537418.1.84264 WP_000537418.1.84312 WP_000537418.1.84313 WP_000537418.1.84331 WP_000537418.1.84339 WP_000537418.1.84348 WP_000537418.1.84405 WP_000537418.1.84410 WP_000537418.1.84436 WP_000537418.1.8444 WP_000537418.1.84462 WP_000537418.1.84467 WP_000537418.1.84473 WP_000537418.1.84482 WP_000537418.1.84484 WP_000537418.1.84511 WP_000537418.1.84518 WP_000537418.1.84534 WP_000537418.1.84584 WP_000537418.1.84635 WP_000537418.1.84656 WP_000537418.1.84657 WP_000537418.1.84668 WP_000537418.1.84675 WP_000537418.1.84697 WP_000537418.1.84738 WP_000537418.1.84740 WP_000537418.1.84768 WP_000537418.1.8477 WP_000537418.1.84841 WP_000537418.1.84850 WP_000537418.1.84875 WP_000537418.1.84877 WP_000537418.1.84878 WP_000537418.1.84881 WP_000537418.1.84894 WP_000537418.1.84916 WP_000537418.1.84929 WP_000537418.1.84948 WP_000537418.1.84966 WP_000537418.1.84972 WP_000537418.1.84977 WP_000537418.1.84989 WP_000537418.1.84994 WP_000537418.1.85002 WP_000537418.1.85011 WP_000537418.1.85085 WP_000537418.1.85098 WP_000537418.1.85105 WP_000537418.1.85106 WP_000537418.1.85112 WP_000537418.1.85129 WP_000537418.1.85141 WP_000537418.1.85155 WP_000537418.1.85156 WP_000537418.1.85175 WP_000537418.1.85247 WP_000537418.1.85253 WP_000537418.1.85255 WP_000537418.1.85260 WP_000537418.1.85305 WP_000537418.1.85310 WP_000537418.1.85323 WP_000537418.1.85335 WP_000537418.1.85342 WP_000537418.1.85369 WP_000537418.1.85385 WP_000537418.1.85525 WP_000537418.1.85546 WP_000537418.1.85558 WP_000537418.1.85563 WP_000537418.1.8560 WP_000537418.1.85601 WP_000537418.1.85621 WP_000537418.1.8564 WP_000537418.1.85657 WP_000537418.1.85685 WP_000537418.1.85722 WP_000537418.1.85752 WP_000537418.1.85767 WP_000537418.1.85772 WP_000537418.1.85773 WP_000537418.1.8579 WP_000537418.1.85793 WP_000537418.1.85800 WP_000537418.1.85857 WP_000537418.1.85895 WP_000537418.1.8592 WP_000537418.1.85939 WP_000537418.1.85948 WP_000537418.1.86 WP_000537418.1.86001 WP_000537418.1.86035 WP_000537418.1.86063 WP_000537418.1.8607 WP_000537418.1.86105 WP_000537418.1.86115 WP_000537418.1.86145 WP_000537418.1.86149 WP_000537418.1.86161 WP_000537418.1.86171 WP_000537418.1.86176 WP_000537418.1.86181 WP_000537418.1.86189 WP_000537418.1.8621 WP_000537418.1.86210 WP_000537418.1.86225 WP_000537418.1.86228 WP_000537418.1.86255 WP_000537418.1.86266 WP_000537418.1.86280 WP_000537418.1.86283 WP_000537418.1.86307 WP_000537418.1.86340 WP_000537418.1.8635 WP_000537418.1.86355 WP_000537418.1.86371 WP_000537418.1.86393 WP_000537418.1.86411 WP_000537418.1.86412 WP_000537418.1.86437 WP_000537418.1.86451 WP_000537418.1.86452 WP_000537418.1.86454 WP_000537418.1.86461 WP_000537418.1.86475 WP_000537418.1.86492 WP_000537418.1.86518 WP_000537418.1.8652 WP_000537418.1.86574 WP_000537418.1.86598 WP_000537418.1.86609 WP_000537418.1.86617 WP_000537418.1.86640 WP_000537418.1.86667 WP_000537418.1.86674 WP_000537418.1.86681 WP_000537418.1.86691 WP_000537418.1.86707 WP_000537418.1.86717 WP_000537418.1.86787 WP_000537418.1.86833 WP_000537418.1.86846 WP_000537418.1.86848 WP_000537418.1.8687 WP_000537418.1.86935 WP_000537418.1.86956 WP_000537418.1.86959 WP_000537418.1.86975 WP_000537418.1.86994 WP_000537418.1.86997 WP_000537418.1.87059 WP_000537418.1.87075 WP_000537418.1.87076 WP_000537418.1.87109 WP_000537418.1.87177 WP_000537418.1.87189 WP_000537418.1.87199 WP_000537418.1.87247 WP_000537418.1.87249 WP_000537418.1.87254 WP_000537418.1.87310 WP_000537418.1.87339 WP_000537418.1.87358 WP_000537418.1.87382 WP_000537418.1.87389 WP_000537418.1.87400 WP_000537418.1.87410 WP_000537418.1.87465 WP_000537418.1.87557 WP_000537418.1.87563 WP_000537418.1.87568 WP_000537418.1.87574 WP_000537418.1.87608 WP_000537418.1.87610 WP_000537418.1.87616 WP_000537418.1.87639 WP_000537418.1.87655 WP_000537418.1.87694 WP_000537418.1.8771 WP_000537418.1.87721 WP_000537418.1.87726 WP_000537418.1.87728 WP_000537418.1.87786 WP_000537418.1.87788 WP_000537418.1.87789 WP_000537418.1.87834 WP_000537418.1.87857 WP_000537418.1.87914 WP_000537418.1.87919 WP_000537418.1.87973 WP_000537418.1.87976 WP_000537418.1.87980 WP_000537418.1.87984 WP_000537418.1.87989 WP_000537418.1.880 WP_000537418.1.88017 WP_000537418.1.88066 WP_000537418.1.88088 WP_000537418.1.88110 WP_000537418.1.88149 WP_000537418.1.88189 WP_000537418.1.88197 WP_000537418.1.88238 WP_000537418.1.88252 WP_000537418.1.88263 WP_000537418.1.88301 WP_000537418.1.88304 WP_000537418.1.88352 WP_000537418.1.88376 WP_000537418.1.88379 WP_000537418.1.88384 WP_000537418.1.88413 WP_000537418.1.88427 WP_000537418.1.8843 WP_000537418.1.88434 WP_000537418.1.88438 WP_000537418.1.88462 WP_000537418.1.88505 WP_000537418.1.88524 WP_000537418.1.88528 WP_000537418.1.88535 WP_000537418.1.88539 WP_000537418.1.8854 WP_000537418.1.88557 WP_000537418.1.88577 WP_000537418.1.88598 WP_000537418.1.88603 WP_000537418.1.88607 WP_000537418.1.88646 WP_000537418.1.88667 WP_000537418.1.88678 WP_000537418.1.88685 WP_000537418.1.88709 WP_000537418.1.88710 WP_000537418.1.88711 WP_000537418.1.88720 WP_000537418.1.88729 WP_000537418.1.88732 WP_000537418.1.88759 WP_000537418.1.8879 WP_000537418.1.88803 WP_000537418.1.88834 WP_000537418.1.88864 WP_000537418.1.88883 WP_000537418.1.88891 WP_000537418.1.88950 WP_000537418.1.88953 WP_000537418.1.88961 WP_000537418.1.89018 WP_000537418.1.89050 WP_000537418.1.8906 WP_000537418.1.89067 WP_000537418.1.89090 WP_000537418.1.89099 WP_000537418.1.89111 WP_000537418.1.89163 WP_000537418.1.89183 WP_000537418.1.89197 WP_000537418.1.89200 WP_000537418.1.89255 WP_000537418.1.8928 WP_000537418.1.89305 WP_000537418.1.89322 WP_000537418.1.89335 WP_000537418.1.8938 WP_000537418.1.89385 WP_000537418.1.894 WP_000537418.1.89400 WP_000537418.1.89403 WP_000537418.1.89405 WP_000537418.1.89416 WP_000537418.1.89432 WP_000537418.1.8945 WP_000537418.1.89458 WP_000537418.1.89468 WP_000537418.1.89471 WP_000537418.1.89474 WP_000537418.1.89479 WP_000537418.1.89492 WP_000537418.1.89510 WP_000537418.1.89569 WP_000537418.1.89601 WP_000537418.1.89605 WP_000537418.1.89646 WP_000537418.1.89656 WP_000537418.1.89674 WP_000537418.1.89679 WP_000537418.1.89700 WP_000537418.1.89710 WP_000537418.1.89768 WP_000537418.1.89781 WP_000537418.1.89788 WP_000537418.1.89818 WP_000537418.1.89839 WP_000537418.1.89841 WP_000537418.1.89852 WP_000537418.1.89859 WP_000537418.1.89895 WP_000537418.1.89899 WP_000537418.1.89915 WP_000537418.1.89920 WP_000537418.1.89923 WP_000537418.1.89925 WP_000537418.1.89959 WP_000537418.1.89977 WP_000537418.1.89988 WP_000537418.1.90017 WP_000537418.1.90063 WP_000537418.1.90078 WP_000537418.1.9010 WP_000537418.1.90115 WP_000537418.1.90128 WP_000537418.1.90139 WP_000537418.1.90146 WP_000537418.1.90156 WP_000537418.1.90168 WP_000537418.1.90182 WP_000537418.1.90205 WP_000537418.1.90219 WP_000537418.1.90249 WP_000537418.1.90256 WP_000537418.1.90257 WP_000537418.1.90266 WP_000537418.1.90332 WP_000537418.1.90342 WP_000537418.1.90349 WP_000537418.1.90358 WP_000537418.1.9036 WP_000537418.1.90389 WP_000537418.1.90405 WP_000537418.1.90435 WP_000537418.1.90436 WP_000537418.1.90467 WP_000537418.1.90511 WP_000537418.1.90520 WP_000537418.1.90536 WP_000537418.1.9059 WP_000537418.1.90591 WP_000537418.1.9061 WP_000537418.1.90626 WP_000537418.1.90703 WP_000537418.1.90706 WP_000537418.1.90758 WP_000537418.1.90799 WP_000537418.1.90813 WP_000537418.1.90828 WP_000537418.1.90837 WP_000537418.1.9084 WP_000537418.1.90848 WP_000537418.1.90864 WP_000537418.1.90865 WP_000537418.1.90873 WP_000537418.1.90890 WP_000537418.1.90951 WP_000537418.1.90967 WP_000537418.1.90979 WP_000537418.1.9098 WP_000537418.1.90997 WP_000537418.1.91018 WP_000537418.1.9104 WP_000537418.1.91072 WP_000537418.1.91088 WP_000537418.1.91094 WP_000537418.1.91113 WP_000537418.1.91117 WP_000537418.1.91138 WP_000537418.1.91153 WP_000537418.1.91170 WP_000537418.1.9118 WP_000537418.1.91268 WP_000537418.1.91277 WP_000537418.1.91288 WP_000537418.1.91290 WP_000537418.1.91340 WP_000537418.1.91341 WP_000537418.1.91356 WP_000537418.1.91384 WP_000537418.1.91397 WP_000537418.1.91414 WP_000537418.1.91445 WP_000537418.1.91462 WP_000537418.1.915 WP_000537418.1.91511 WP_000537418.1.91516 WP_000537418.1.91526 WP_000537418.1.91548 WP_000537418.1.91551 WP_000537418.1.91565 WP_000537418.1.9157 WP_000537418.1.91594 WP_000537418.1.91596 WP_000537418.1.9160 WP_000537418.1.91630 WP_000537418.1.91643 WP_000537418.1.91644 WP_000537418.1.91651 WP_000537418.1.91672 WP_000537418.1.9168 WP_000537418.1.91685 WP_000537418.1.9169 WP_000537418.1.91701 WP_000537418.1.9171 WP_000537418.1.91739 WP_000537418.1.91777 WP_000537418.1.91779 WP_000537418.1.91782 WP_000537418.1.91787 WP_000537418.1.91793 WP_000537418.1.91801 WP_000537418.1.9185 WP_000537418.1.91850 WP_000537418.1.91863 WP_000537418.1.91871 WP_000537418.1.91879 WP_000537418.1.91951 WP_000537418.1.91959 WP_000537418.1.91994 WP_000537418.1.92014 WP_000537418.1.92029 WP_000537418.1.92048 WP_000537418.1.92058 WP_000537418.1.921 WP_000537418.1.92102 WP_000537418.1.92114 WP_000537418.1.9215 WP_000537418.1.92163 WP_000537418.1.92180 WP_000537418.1.92195 WP_000537418.1.92215 WP_000537418.1.92224 WP_000537418.1.92311 WP_000537418.1.92323 WP_000537418.1.92361 WP_000537418.1.924 WP_000537418.1.92434 WP_000537418.1.92462 WP_000537418.1.92495 WP_000537418.1.92496 WP_000537418.1.92506 WP_000537418.1.92532 WP_000537418.1.92535 WP_000537418.1.92568 WP_000537418.1.92571 WP_000537418.1.92577 WP_000537418.1.92614 WP_000537418.1.92615 WP_000537418.1.92634 WP_000537418.1.9264 WP_000537418.1.9266 WP_000537418.1.92668 WP_000537418.1.92708 WP_000537418.1.92742 WP_000537418.1.92781 WP_000537418.1.92792 WP_000537418.1.92793 WP_000537418.1.92796 WP_000537418.1.92819 WP_000537418.1.92845 WP_000537418.1.92865 WP_000537418.1.92932 WP_000537418.1.92943 WP_000537418.1.92953 WP_000537418.1.92989 WP_000537418.1.92991 WP_000537418.1.93005 WP_000537418.1.93016 WP_000537418.1.93019 WP_000537418.1.93027 WP_000537418.1.93048 WP_000537418.1.93054 WP_000537418.1.93069 WP_000537418.1.93072 WP_000537418.1.93085 WP_000537418.1.93100 WP_000537418.1.93150 WP_000537418.1.93175 WP_000537418.1.93252 WP_000537418.1.93267 WP_000537418.1.93276 WP_000537418.1.93309 WP_000537418.1.93312 WP_000537418.1.93338 WP_000537418.1.93379 WP_000537418.1.93388 WP_000537418.1.93427 WP_000537418.1.93428 WP_000537418.1.93463 WP_000537418.1.93468 WP_000537418.1.93509 WP_000537418.1.93531 WP_000537418.1.93569 WP_000537418.1.93601 WP_000537418.1.93626 WP_000537418.1.93629 WP_000537418.1.93630 WP_000537418.1.93634 WP_000537418.1.93637 WP_000537418.1.93652 WP_000537418.1.93665 WP_000537418.1.93670 WP_000537418.1.93673 WP_000537418.1.93695 WP_000537418.1.93733 WP_000537418.1.93742 WP_000537418.1.93743 WP_000537418.1.93745 WP_000537418.1.93755 WP_000537418.1.938 WP_000537418.1.93800 WP_000537418.1.93821 WP_000537418.1.93873 WP_000537418.1.93877 WP_000537418.1.939 WP_000537418.1.93900 WP_000537418.1.93911 WP_000537418.1.93918 WP_000537418.1.93921 WP_000537418.1.93951 WP_000537418.1.94008 WP_000537418.1.94011 WP_000537418.1.94025 WP_000537418.1.94057 WP_000537418.1.94156 WP_000537418.1.94176 WP_000537418.1.94187 WP_000537418.1.94213 WP_000537418.1.94232 WP_000537418.1.9426 WP_000537418.1.94271 WP_000537418.1.94298 WP_000537418.1.94302 WP_000537418.1.94317 WP_000537418.1.94343 WP_000537418.1.94353 WP_000537418.1.94388 WP_000537418.1.94404 WP_000537418.1.94429 WP_000537418.1.94430 WP_000537418.1.94445 WP_000537418.1.94475 WP_000537418.1.94497 WP_000537418.1.94507 WP_000537418.1.94516 WP_000537418.1.94523 WP_000537418.1.94542 WP_000537418.1.94544 WP_000537418.1.94548 WP_000537418.1.9457 WP_000537418.1.94578 WP_000537418.1.94580 WP_000537418.1.94589 WP_000537418.1.94626 WP_000537418.1.94676 WP_000537418.1.94690 WP_000537418.1.94692 WP_000537418.1.94738 WP_000537418.1.94753 WP_000537418.1.94754 WP_000537418.1.94764 WP_000537418.1.94787 WP_000537418.1.94790 WP_000537418.1.948 WP_000537418.1.94801 WP_000537418.1.94806 WP_000537418.1.94808 WP_000537418.1.94822 WP_000537418.1.94836 WP_000537418.1.94847 WP_000537418.1.94889 WP_000537418.1.9489 WP_000537418.1.94898 WP_000537418.1.949 WP_000537418.1.9491 WP_000537418.1.94935 WP_000537418.1.94938 WP_000537418.1.94949 WP_000537418.1.94963 WP_000537418.1.94991 WP_000537418.1.94993 WP_000537418.1.95005 WP_000537418.1.95011 WP_000537418.1.95022 WP_000537418.1.95028 WP_000537418.1.95035 WP_000537418.1.95036 WP_000537418.1.95037 WP_000537418.1.95062 WP_000537418.1.95129 WP_000537418.1.95161 WP_000537418.1.95198 WP_000537418.1.95233 WP_000537418.1.95243 WP_000537418.1.95244 WP_000537418.1.95332 WP_000537418.1.95368 WP_000537418.1.95381 WP_000537418.1.95390 WP_000537418.1.95395 WP_000537418.1.95403 WP_000537418.1.95424 WP_000537418.1.95431 WP_000537418.1.95438 WP_000537418.1.95490 WP_000537418.1.95521 WP_000537418.1.95563 WP_000537418.1.9559 WP_000537418.1.95595 WP_000537418.1.95596 WP_000537418.1.95604 WP_000537418.1.95611 WP_000537418.1.95634 WP_000537418.1.95756 WP_000537418.1.95759 WP_000537418.1.95771 WP_000537418.1.95800 WP_000537418.1.95821 WP_000537418.1.95824 WP_000537418.1.95827 WP_000537418.1.95834 WP_000537418.1.95835 WP_000537418.1.95849 WP_000537418.1.95916 WP_000537418.1.95919 WP_000537418.1.95932 WP_000537418.1.95951 WP_000537418.1.960 WP_000537418.1.96015 WP_000537418.1.96032 WP_000537418.1.96053 WP_000537418.1.96066 WP_000537418.1.96086 WP_000537418.1.96110 WP_000537418.1.96114 WP_000537418.1.9616 WP_000537418.1.96215 WP_000537418.1.96222 WP_000537418.1.96247 WP_000537418.1.96279 WP_000537418.1.96281 WP_000537418.1.96290 WP_000537418.1.96293 WP_000537418.1.96299 WP_000537418.1.96303 WP_000537418.1.96339 WP_000537418.1.96341 WP_000537418.1.96394 WP_000537418.1.96417 WP_000537418.1.96420 WP_000537418.1.96425 WP_000537418.1.96450 WP_000537418.1.96457 WP_000537418.1.96479 WP_000537418.1.96480 WP_000537418.1.96484 WP_000537418.1.96494 WP_000537418.1.96562 WP_000537418.1.9657 WP_000537418.1.96585 WP_000537418.1.96609 WP_000537418.1.9661 WP_000537418.1.96659 WP_000537418.1.9668 WP_000537418.1.96683 WP_000537418.1.96725 WP_000537418.1.96743 WP_000537418.1.96753 WP_000537418.1.96779 WP_000537418.1.96796 WP_000537418.1.96817 WP_000537418.1.96850 WP_000537418.1.96894 WP_000537418.1.9690 WP_000537418.1.9691 WP_000537418.1.96936 WP_000537418.1.96944 WP_000537418.1.96984 WP_000537418.1.96989 WP_000537418.1.97011 WP_000537418.1.97027 WP_000537418.1.97049 WP_000537418.1.97059 WP_000537418.1.9708 WP_000537418.1.97119 WP_000537418.1.97123 WP_000537418.1.97193 WP_000537418.1.97195 WP_000537418.1.97200 WP_000537418.1.97231 WP_000537418.1.97238 WP_000537418.1.97248 WP_000537418.1.9729 WP_000537418.1.97344 WP_000537418.1.97356 WP_000537418.1.97360 WP_000537418.1.97361 WP_000537418.1.9740 WP_000537418.1.97402 WP_000537418.1.97418 WP_000537418.1.97434 WP_000537418.1.97439 WP_000537418.1.97459 WP_000537418.1.9747 WP_000537418.1.97502 WP_000537418.1.97513 WP_000537418.1.97527 WP_000537418.1.97538 WP_000537418.1.97560 WP_000537418.1.97632 WP_000537418.1.97667 WP_000537418.1.97675 WP_000537418.1.97677 WP_000537418.1.97685 WP_000537418.1.9770 WP_000537418.1.97705 WP_000537418.1.97711 WP_000537418.1.97775 WP_000537418.1.97789 WP_000537418.1.97802 WP_000537418.1.97822 WP_000537418.1.97825 WP_000537418.1.97871 WP_000537418.1.97895 WP_000537418.1.97930 WP_000537418.1.97932 WP_000537418.1.97937 WP_000537418.1.97962 WP_000537418.1.97982 WP_000537418.1.97996 WP_000537418.1.98012 WP_000537418.1.98026 WP_000537418.1.9803 WP_000537418.1.98046 WP_000537418.1.98082 WP_000537418.1.98083 WP_000537418.1.981 WP_000537418.1.98115 WP_000537418.1.98139 WP_000537418.1.98155 WP_000537418.1.9816 WP_000537418.1.9817 WP_000537418.1.98176 WP_000537418.1.98187 WP_000537418.1.98205 WP_000537418.1.98208 WP_000537418.1.98220 WP_000537418.1.98235 WP_000537418.1.98239 WP_000537418.1.98241 WP_000537418.1.98279 WP_000537418.1.98284 WP_000537418.1.98292 WP_000537418.1.98294 WP_000537418.1.98301 WP_000537418.1.98312 WP_000537418.1.98355 WP_000537418.1.98357 WP_000537418.1.98384 WP_000537418.1.98400 WP_000537418.1.98424 WP_000537418.1.9844 WP_000537418.1.98442 WP_000537418.1.98477 WP_000537418.1.98498 WP_000537418.1.98543 WP_000537418.1.98549 WP_000537418.1.98569 WP_000537418.1.98578 WP_000537418.1.9858 WP_000537418.1.98603 WP_000537418.1.98628 WP_000537418.1.9864 WP_000537418.1.98641 WP_000537418.1.98654 WP_000537418.1.98665 WP_000537418.1.98668 WP_000537418.1.98683 WP_000537418.1.98776 WP_000537418.1.98784 WP_000537418.1.9883 WP_000537418.1.98875 WP_000537418.1.98886 WP_000537418.1.98908 WP_000537418.1.98920 WP_000537418.1.98976 WP_000537418.1.98988 WP_000537418.1.99029 WP_000537418.1.99046 WP_000537418.1.99053 WP_000537418.1.9907 WP_000537418.1.99101 WP_000537418.1.99110 WP_000537418.1.99168 WP_000537418.1.99182 WP_000537418.1.99209 WP_000537418.1.99234 WP_000537418.1.99246 WP_000537418.1.99265 WP_000537418.1.99292 WP_000537418.1.99295 WP_000537418.1.99302 WP_000537418.1.99304 WP_000537418.1.99334 WP_000537418.1.99345 WP_000537418.1.99361 WP_000537418.1.99392 WP_000537418.1.9940 WP_000537418.1.99400 WP_000537418.1.99427 WP_000537418.1.99446 WP_000537418.1.99453 WP_000537418.1.99471 WP_000537418.1.99475 WP_000537418.1.99486 WP_000537418.1.99487 WP_000537418.1.99501 WP_000537418.1.99511 WP_000537418.1.99534 WP_000537418.1.99562 WP_000537418.1.99592 WP_000537418.1.99602 WP_000537418.1.99603 WP_000537418.1.99619 WP_000537418.1.99632 WP_000537418.1.99641 WP_000537418.1.99666 WP_000537418.1.99692 WP_000537418.1.99774 WP_000537418.1.99791 WP_000537418.1.99804 WP_000537418.1.99827 WP_000537418.1.99869 WP_000537418.1.99912 WP_000537418.1.99929 WP_000537418.1.99986 YP_006780056.1.12065 YP_403939.1.10455 gi|209400308|ref|YP_002269561.1| gi|157160410|ref|YP_001457728.1| gi|260843138|ref|YP_003220916.1| gi|170080546|ref|YP_001729866.1| gi|386613106|ref|YP_006132772.1| gi|387881502|ref|YP_006311804.1| gi|82777590|ref|YP_403939.1| gi|254792088|ref|YP_003076925.1| gi|170020710|ref|YP_001725664.1| gi|15830227|ref|NP_309000.1| 155864.Z1232 300267.SDY_2373 300268.SBO_0821 300269.SSON_0889 316385.ECDH10B_0958 316407.trxB 331111.EcE24377A_0962 331112.EcHS_A0992 386585.ECs0973 409438.ECSE_0946 413997.ECB_00892 444450.ECH74115_1050 469008.ECBD_2707 481805.EcolC_2708 511145.b0888 544404.ECSP_0993 585034.ECIAI1_0928 585055.EC55989_0933 585395.ECO103_0931 585396.ECO111_0956 595496.BWG_0740 gi|407468361|ref|YP_006785197.1| gi|209918137|ref|YP_002292221.1| gi|74311446|ref|YP_309865.1| gi|387620613|ref|YP_006128240.1| gi|378713709|ref|YP_005278602.1| gi|471332942|ref|YP_007556419.1| gi|251784430|ref|YP_002998734.1| gi|253774083|ref|YP_003036914.1| gi|386704069|ref|YP_006167916.1| gi|82543374|ref|YP_407321.1| gi|16128855|ref|NP_415408.1| gi|383177526|ref|YP_005455531.1| gi|386708699|ref|YP_006172420.1| gi|218553474|ref|YP_002386387.1| gi|157155789|ref|YP_001462085.1| gi|410483459|ref|YP_006771005.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]