SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|218555650|ref|YP_002388563.1| from Escherichia coli IAI1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|218555650|ref|YP_002388563.1|
Domain Number 1 Region: 1-362
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 3.38e-110
Family FMN-linked oxidoreductases 0.00000000000998
Further Details:      
 
Domain Number 2 Region: 333-519
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 1.02e-41
Family N-terminal domain of adrenodoxin reductase-like 0.00000032
Further Details:      
 
Domain Number 3 Region: 467-627
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.97e-27
Family C-terminal domain of adrenodoxin reductase-like 0.0000000611
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|218555650|ref|YP_002388563.1|
Sequence length 672
Comment 2,4-dienoyl-CoA reductase, NADH and FMN-linked [Escherichia coli IAI1]
Sequence
MSYPSLFAPLDLGFTTLKNRVLMGSMHTGLEEYPDGAERLAAFYAERARHGVALIVSGGI
APDLTGVGMEGGAMLNDASQIPHHRTITEAVHQEGGKIALQILHTGRYSYQPHLVAPSAL
QAPINRFVPHELTHEEILQLIDDFAHCAQLAREAGYDGVEVMGSEGYLINEFLTLRTNQR
SDQWGGDYRNRMRFAVEVVRAVRERVGNDFIIIYRLSMLDLVEDGGTFAETVELAQAIEA
AGATIINTGIGWHEARIPTIATPVPRGAFTWVTRKLKGHVSLPLVTTNRINDPQVADDIL
SRGDADMVSMARPFLADAELLSKAQSGRADEINTCIGCNQACLDQIFVGKVTSCLVNPRA
CHETKMPILPAVQKKNLAVVGAGPAGLAFAINAAARGHQVTLFDAHSEIGGQFNIAKQIP
GKEEFYETLRYYHRMIEVTGVTLKLNHTVTADQLQAFDETILASGIVPRVPPIDGIDHPK
VLSYLDVLRDKAPVGNKVAIIGCGGIGFDTAMYLSQPGESTSQNIAGFCNEWGIDSSLQQ
AGGLSPQGMQIPRSPRQIVMLQRKASKPGQGLGKTTGWIHRTTLLSRGVKMIPGVSYQKI
DDDGLHVVINGETQVLAVDNVVICAGQEPNRALAQPLIDSGKTVHLIGGCDVAMELDARR
AIAQGTRLALEI
Download sequence
Identical sequences WP_000121459.1.100066 WP_000121459.1.11524 WP_000121459.1.12566 WP_000121459.1.15377 WP_000121459.1.16194 WP_000121459.1.1766 WP_000121459.1.17961 WP_000121459.1.18649 WP_000121459.1.20519 WP_000121459.1.21104 WP_000121459.1.24136 WP_000121459.1.26055 WP_000121459.1.26569 WP_000121459.1.29683 WP_000121459.1.31860 WP_000121459.1.32709 WP_000121459.1.35376 WP_000121459.1.36070 WP_000121459.1.37773 WP_000121459.1.37887 WP_000121459.1.38120 WP_000121459.1.38257 WP_000121459.1.40403 WP_000121459.1.4049 WP_000121459.1.41147 WP_000121459.1.4142 WP_000121459.1.42962 WP_000121459.1.43363 WP_000121459.1.45968 WP_000121459.1.46197 WP_000121459.1.47962 WP_000121459.1.50412 WP_000121459.1.50996 WP_000121459.1.5128 WP_000121459.1.52171 WP_000121459.1.54359 WP_000121459.1.54591 WP_000121459.1.55041 WP_000121459.1.55115 WP_000121459.1.56871 WP_000121459.1.59293 WP_000121459.1.59621 WP_000121459.1.62041 WP_000121459.1.6212 WP_000121459.1.62447 WP_000121459.1.62850 WP_000121459.1.63393 WP_000121459.1.64438 WP_000121459.1.68566 WP_000121459.1.70748 WP_000121459.1.70967 WP_000121459.1.77477 WP_000121459.1.77626 WP_000121459.1.81316 WP_000121459.1.82246 WP_000121459.1.82326 WP_000121459.1.83684 WP_000121459.1.90626 WP_000121459.1.90864 WP_000121459.1.91565 WP_000121459.1.94232 WP_000121459.1.94317 WP_000121459.1.95161 WP_000121459.1.95243 WP_000121459.1.96817 WP_000121459.1.98665 WP_000121459.1.99511 gi|218555650|ref|YP_002388563.1| 585034.ECIAI1_3228

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]