SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|218556048|ref|YP_002388961.1| from Escherichia coli IAI1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|218556048|ref|YP_002388961.1|
Domain Number 1 Region: 1-365
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.31e-56
Family FAD/NAD-linked reductases, N-terminal and central domains 0.000000231
Further Details:      
 
Domain Number 2 Region: 336-450
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 4.47e-37
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.000000413
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|218556048|ref|YP_002388961.1|
Sequence length 450
Comment glutathione reductase [Escherichia coli IAI1]
Sequence
MTKHYDYIAIGGGSGGIASINRAAMYGQKCALIEAKELGGTCVNVGCVPKKVMWHAAQIR
EAIHMYGPDYGFDTTINKFNWETLIASRTAYIDRIHTSYENVLGKNNVDVIKGFARFVDA
KTLEVNGETITADHILIATGGRPSHPDIPGVEYGIDSDGFFALPALPERVAVVGAGYIAV
ELAGVINGLGAKTHLFVRKHAPLRSFDPMISETLVEVMNAEGPQLHTNAIPKAVVKNADG
SLTLELEDGRSETVDCLIWAIGREPANDNINLEAAGVKTNEKGYIVVDKYQNTNIEGIYA
VGDNTGAVELTPVAVAAGRRLSERLFNNKPDEHLDYSNIPTVVFSHPPIGTVGLTEPQAR
EQYGDDQVKVYKSSFTAMYTAVTTHRQPCRMKLVCVGSEEKIVGIHGIGFGMDEMLQGFA
VALKMGATKKDFDNTVAIHPTAAEEFVTMR
Download sequence
Identical sequences A0A026UYD5 A0A027U1T0 A0A027ZI45 A0A028E0E2 A0A069XFK8 A0A070FL15 A0A070SMS3 A0A070UIV5 A0A073G1J6 A0A074HN26 A0A077ZIX0 A0A080FNA0 A0A0A0FHF1 A0A0A8UL74 A0A0E0U5Y5 A0A0E0XT72 A0A0E1M2P7 A0A0M7NRN4 A0A125WXP7 A0A140N2B1 A0A142H804 A0A1H0HXR9 A0A1S6TH16 A0A1X3JAQ0 A0A1X3KXJ2 A0A222QS34 A0A236LNJ0 A7ZT36 B6I362 B7L5Y1 C8TYC0 C8UHX8 D6I2H4 D7XW14 D7XYS7 D8E7S5 E0IZM3 E1IX11 E1J930 E3PM91 E6BIR2 E9TG12 F4NNM2 F4SQN5 F4VKE0 G0F8F2 H4UQM4 I0VW86 I2SW55 I2UK32 I2WB60 I2X1H6 I2X6E8 J7QS91 J7R761 K4V4A1 L2VGZ3 M9FMS3 S1CJM2 S1H5Q6 S1IL40 T9CJZ8 U9XPN8 V2RYA5 V6FUL9 V8FB06 W1ERE1
gi|386711380|ref|YP_006175101.1| gi|260857604|ref|YP_003231495.1| gi|209920956|ref|YP_002295040.1| gi|251786748|ref|YP_003001052.1| gi|407479867|ref|YP_006777016.1| gi|260846288|ref|YP_003224066.1| gi|378711075|ref|YP_005275968.1| gi|157158049|ref|YP_001464965.1| gi|254163423|ref|YP_003046531.1| gi|407471480|ref|YP_006782077.1| gi|410480424|ref|YP_006767970.1| gi|253771671|ref|YP_003034502.1| WP_000160808.1.100044 WP_000160808.1.100066 WP_000160808.1.100085 WP_000160808.1.100111 WP_000160808.1.100185 WP_000160808.1.100251 WP_000160808.1.100252 WP_000160808.1.100283 WP_000160808.1.100346 WP_000160808.1.100441 WP_000160808.1.100444 WP_000160808.1.100451 WP_000160808.1.100487 WP_000160808.1.100499 WP_000160808.1.10051 WP_000160808.1.100543 WP_000160808.1.100571 WP_000160808.1.100573 WP_000160808.1.100614 WP_000160808.1.100667 WP_000160808.1.10067 WP_000160808.1.10068 WP_000160808.1.100689 WP_000160808.1.100718 WP_000160808.1.100752 WP_000160808.1.100778 WP_000160808.1.100796 WP_000160808.1.10080 WP_000160808.1.100824 WP_000160808.1.100836 WP_000160808.1.10086 WP_000160808.1.100867 WP_000160808.1.100928 WP_000160808.1.100933 WP_000160808.1.100990 WP_000160808.1.101096 WP_000160808.1.101102 WP_000160808.1.101157 WP_000160808.1.101158 WP_000160808.1.101186 WP_000160808.1.101216 WP_000160808.1.10126 WP_000160808.1.101282 WP_000160808.1.101289 WP_000160808.1.101359 WP_000160808.1.101387 WP_000160808.1.101418 WP_000160808.1.101423 WP_000160808.1.101436 WP_000160808.1.101468 WP_000160808.1.10154 WP_000160808.1.101630 WP_000160808.1.101653 WP_000160808.1.101654 WP_000160808.1.101668 WP_000160808.1.101686 WP_000160808.1.10173 WP_000160808.1.101737 WP_000160808.1.101747 WP_000160808.1.101777 WP_000160808.1.101786 WP_000160808.1.101822 WP_000160808.1.10184 WP_000160808.1.101840 WP_000160808.1.101845 WP_000160808.1.101865 WP_000160808.1.10190 WP_000160808.1.101900 WP_000160808.1.101908 WP_000160808.1.101913 WP_000160808.1.101947 WP_000160808.1.101952 WP_000160808.1.102069 WP_000160808.1.102122 WP_000160808.1.10235 WP_000160808.1.10252 WP_000160808.1.10379 WP_000160808.1.1040 WP_000160808.1.10400 WP_000160808.1.10417 WP_000160808.1.10461 WP_000160808.1.10491 WP_000160808.1.10538 WP_000160808.1.1058 WP_000160808.1.10607 WP_000160808.1.10651 WP_000160808.1.10673 WP_000160808.1.1071 WP_000160808.1.10729 WP_000160808.1.1073 WP_000160808.1.1074 WP_000160808.1.10763 WP_000160808.1.10798 WP_000160808.1.10833 WP_000160808.1.10922 WP_000160808.1.10940 WP_000160808.1.10989 WP_000160808.1.11006 WP_000160808.1.11032 WP_000160808.1.11071 WP_000160808.1.11091 WP_000160808.1.11118 WP_000160808.1.11121 WP_000160808.1.11133 WP_000160808.1.112 WP_000160808.1.1122 WP_000160808.1.11241 WP_000160808.1.11408 WP_000160808.1.11436 WP_000160808.1.11437 WP_000160808.1.11524 WP_000160808.1.11578 WP_000160808.1.11616 WP_000160808.1.11645 WP_000160808.1.1168 WP_000160808.1.11699 WP_000160808.1.11748 WP_000160808.1.11759 WP_000160808.1.11801 WP_000160808.1.11803 WP_000160808.1.11844 WP_000160808.1.1186 WP_000160808.1.11949 WP_000160808.1.11955 WP_000160808.1.1196 WP_000160808.1.11982 WP_000160808.1.11985 WP_000160808.1.12030 WP_000160808.1.12036 WP_000160808.1.12060 WP_000160808.1.1212 WP_000160808.1.12279 WP_000160808.1.12319 WP_000160808.1.12320 WP_000160808.1.12342 WP_000160808.1.12344 WP_000160808.1.12415 WP_000160808.1.1242 WP_000160808.1.12478 WP_000160808.1.12542 WP_000160808.1.12558 WP_000160808.1.12566 WP_000160808.1.12623 WP_000160808.1.12645 WP_000160808.1.12675 WP_000160808.1.12680 WP_000160808.1.12693 WP_000160808.1.127 WP_000160808.1.12717 WP_000160808.1.12743 WP_000160808.1.12749 WP_000160808.1.12762 WP_000160808.1.12775 WP_000160808.1.12781 WP_000160808.1.12831 WP_000160808.1.12876 WP_000160808.1.12911 WP_000160808.1.1295 WP_000160808.1.12979 WP_000160808.1.12987 WP_000160808.1.13002 WP_000160808.1.13015 WP_000160808.1.13031 WP_000160808.1.13074 WP_000160808.1.1312 WP_000160808.1.13136 WP_000160808.1.1315 WP_000160808.1.13162 WP_000160808.1.13176 WP_000160808.1.13222 WP_000160808.1.13239 WP_000160808.1.13252 WP_000160808.1.13258 WP_000160808.1.13278 WP_000160808.1.13281 WP_000160808.1.13290 WP_000160808.1.13301 WP_000160808.1.13333 WP_000160808.1.1335 WP_000160808.1.13437 WP_000160808.1.1345 WP_000160808.1.13492 WP_000160808.1.13495 WP_000160808.1.13525 WP_000160808.1.13585 WP_000160808.1.13601 WP_000160808.1.13624 WP_000160808.1.13644 WP_000160808.1.13656 WP_000160808.1.13672 WP_000160808.1.13791 WP_000160808.1.13877 WP_000160808.1.13924 WP_000160808.1.13944 WP_000160808.1.14030 WP_000160808.1.14058 WP_000160808.1.14062 WP_000160808.1.14070 WP_000160808.1.1419 WP_000160808.1.14199 WP_000160808.1.14277 WP_000160808.1.14304 WP_000160808.1.14346 WP_000160808.1.1438 WP_000160808.1.1439 WP_000160808.1.14398 WP_000160808.1.14417 WP_000160808.1.14432 WP_000160808.1.14468 WP_000160808.1.14493 WP_000160808.1.14501 WP_000160808.1.14508 WP_000160808.1.14582 WP_000160808.1.14600 WP_000160808.1.14601 WP_000160808.1.1461 WP_000160808.1.14672 WP_000160808.1.14678 WP_000160808.1.1470 WP_000160808.1.14811 WP_000160808.1.14833 WP_000160808.1.14871 WP_000160808.1.14879 WP_000160808.1.14956 WP_000160808.1.14992 WP_000160808.1.14993 WP_000160808.1.15087 WP_000160808.1.1510 WP_000160808.1.15117 WP_000160808.1.1512 WP_000160808.1.15121 WP_000160808.1.15138 WP_000160808.1.15193 WP_000160808.1.15207 WP_000160808.1.15221 WP_000160808.1.1524 WP_000160808.1.15259 WP_000160808.1.15270 WP_000160808.1.15277 WP_000160808.1.15282 WP_000160808.1.15300 WP_000160808.1.15332 WP_000160808.1.15377 WP_000160808.1.15416 WP_000160808.1.1543 WP_000160808.1.15444 WP_000160808.1.15469 WP_000160808.1.15496 WP_000160808.1.15521 WP_000160808.1.15528 WP_000160808.1.15538 WP_000160808.1.15576 WP_000160808.1.15593 WP_000160808.1.15600 WP_000160808.1.1561 WP_000160808.1.15620 WP_000160808.1.15645 WP_000160808.1.15707 WP_000160808.1.15740 WP_000160808.1.15747 WP_000160808.1.15752 WP_000160808.1.15767 WP_000160808.1.15791 WP_000160808.1.15809 WP_000160808.1.1582 WP_000160808.1.1588 WP_000160808.1.15916 WP_000160808.1.15945 WP_000160808.1.15983 WP_000160808.1.16014 WP_000160808.1.16086 WP_000160808.1.1609 WP_000160808.1.16111 WP_000160808.1.16154 WP_000160808.1.16171 WP_000160808.1.16179 WP_000160808.1.16194 WP_000160808.1.1621 WP_000160808.1.16294 WP_000160808.1.163 WP_000160808.1.1634 WP_000160808.1.16387 WP_000160808.1.16388 WP_000160808.1.1640 WP_000160808.1.16435 WP_000160808.1.16517 WP_000160808.1.16532 WP_000160808.1.16539 WP_000160808.1.16541 WP_000160808.1.16592 WP_000160808.1.16648 WP_000160808.1.16682 WP_000160808.1.16700 WP_000160808.1.16715 WP_000160808.1.16721 WP_000160808.1.1673 WP_000160808.1.16745 WP_000160808.1.16752 WP_000160808.1.16805 WP_000160808.1.16861 WP_000160808.1.16992 WP_000160808.1.17017 WP_000160808.1.17018 WP_000160808.1.17084 WP_000160808.1.1710 WP_000160808.1.17102 WP_000160808.1.17111 WP_000160808.1.17114 WP_000160808.1.17123 WP_000160808.1.17170 WP_000160808.1.17172 WP_000160808.1.17216 WP_000160808.1.17242 WP_000160808.1.17267 WP_000160808.1.17290 WP_000160808.1.17297 WP_000160808.1.17356 WP_000160808.1.17360 WP_000160808.1.17373 WP_000160808.1.17392 WP_000160808.1.17403 WP_000160808.1.17410 WP_000160808.1.17417 WP_000160808.1.17432 WP_000160808.1.17464 WP_000160808.1.17534 WP_000160808.1.1755 WP_000160808.1.17577 WP_000160808.1.17595 WP_000160808.1.17623 WP_000160808.1.1763 WP_000160808.1.17637 WP_000160808.1.1766 WP_000160808.1.1769 WP_000160808.1.17802 WP_000160808.1.17829 WP_000160808.1.17920 WP_000160808.1.17961 WP_000160808.1.17963 WP_000160808.1.17984 WP_000160808.1.18000 WP_000160808.1.18006 WP_000160808.1.18064 WP_000160808.1.18094 WP_000160808.1.18133 WP_000160808.1.18134 WP_000160808.1.18175 WP_000160808.1.18226 WP_000160808.1.18229 WP_000160808.1.18329 WP_000160808.1.18338 WP_000160808.1.18402 WP_000160808.1.18410 WP_000160808.1.1844 WP_000160808.1.18458 WP_000160808.1.18482 WP_000160808.1.18530 WP_000160808.1.18550 WP_000160808.1.18588 WP_000160808.1.18649 WP_000160808.1.18650 WP_000160808.1.1866 WP_000160808.1.1867 WP_000160808.1.18699 WP_000160808.1.18714 WP_000160808.1.18726 WP_000160808.1.188 WP_000160808.1.18858 WP_000160808.1.18861 WP_000160808.1.18874 WP_000160808.1.18876 WP_000160808.1.18899 WP_000160808.1.18923 WP_000160808.1.18936 WP_000160808.1.18983 WP_000160808.1.1906 WP_000160808.1.19090 WP_000160808.1.19147 WP_000160808.1.19150 WP_000160808.1.19194 WP_000160808.1.1925 WP_000160808.1.19277 WP_000160808.1.19297 WP_000160808.1.193 WP_000160808.1.19314 WP_000160808.1.19332 WP_000160808.1.19347 WP_000160808.1.19389 WP_000160808.1.19397 WP_000160808.1.19424 WP_000160808.1.19441 WP_000160808.1.19448 WP_000160808.1.19494 WP_000160808.1.19544 WP_000160808.1.19557 WP_000160808.1.19581 WP_000160808.1.19583 WP_000160808.1.1963 WP_000160808.1.19644 WP_000160808.1.19655 WP_000160808.1.19684 WP_000160808.1.19778 WP_000160808.1.1982 WP_000160808.1.19889 WP_000160808.1.19940 WP_000160808.1.19957 WP_000160808.1.19994 WP_000160808.1.20114 WP_000160808.1.20129 WP_000160808.1.20133 WP_000160808.1.20151 WP_000160808.1.20157 WP_000160808.1.20159 WP_000160808.1.20164 WP_000160808.1.20166 WP_000160808.1.20170 WP_000160808.1.20215 WP_000160808.1.20251 WP_000160808.1.20325 WP_000160808.1.20445 WP_000160808.1.20483 WP_000160808.1.20506 WP_000160808.1.20519 WP_000160808.1.20536 WP_000160808.1.20549 WP_000160808.1.20596 WP_000160808.1.20638 WP_000160808.1.20662 WP_000160808.1.20724 WP_000160808.1.20730 WP_000160808.1.20737 WP_000160808.1.20785 WP_000160808.1.20824 WP_000160808.1.20848 WP_000160808.1.2094 WP_000160808.1.20943 WP_000160808.1.20982 WP_000160808.1.2100 WP_000160808.1.21017 WP_000160808.1.21020 WP_000160808.1.21041 WP_000160808.1.21104 WP_000160808.1.21122 WP_000160808.1.21251 WP_000160808.1.21320 WP_000160808.1.21336 WP_000160808.1.2142 WP_000160808.1.21441 WP_000160808.1.21470 WP_000160808.1.21519 WP_000160808.1.2156 WP_000160808.1.21573 WP_000160808.1.21628 WP_000160808.1.2164 WP_000160808.1.21656 WP_000160808.1.21661 WP_000160808.1.21667 WP_000160808.1.21732 WP_000160808.1.21733 WP_000160808.1.21758 WP_000160808.1.21771 WP_000160808.1.21812 WP_000160808.1.21823 WP_000160808.1.21945 WP_000160808.1.21948 WP_000160808.1.22060 WP_000160808.1.22138 WP_000160808.1.22195 WP_000160808.1.22204 WP_000160808.1.22269 WP_000160808.1.22291 WP_000160808.1.22325 WP_000160808.1.22350 WP_000160808.1.22363 WP_000160808.1.22450 WP_000160808.1.22494 WP_000160808.1.22544 WP_000160808.1.22572 WP_000160808.1.22574 WP_000160808.1.22599 WP_000160808.1.22631 WP_000160808.1.22632 WP_000160808.1.22649 WP_000160808.1.22662 WP_000160808.1.22669 WP_000160808.1.22685 WP_000160808.1.22690 WP_000160808.1.22756 WP_000160808.1.22765 WP_000160808.1.22777 WP_000160808.1.22868 WP_000160808.1.22875 WP_000160808.1.22878 WP_000160808.1.22885 WP_000160808.1.22908 WP_000160808.1.2300 WP_000160808.1.23005 WP_000160808.1.23026 WP_000160808.1.23035 WP_000160808.1.23044 WP_000160808.1.23078 WP_000160808.1.23090 WP_000160808.1.23092 WP_000160808.1.23105 WP_000160808.1.23135 WP_000160808.1.23285 WP_000160808.1.23290 WP_000160808.1.23351 WP_000160808.1.23376 WP_000160808.1.23378 WP_000160808.1.23383 WP_000160808.1.23388 WP_000160808.1.23393 WP_000160808.1.23463 WP_000160808.1.23486 WP_000160808.1.23487 WP_000160808.1.23520 WP_000160808.1.23549 WP_000160808.1.23640 WP_000160808.1.23693 WP_000160808.1.23741 WP_000160808.1.23754 WP_000160808.1.23765 WP_000160808.1.23812 WP_000160808.1.23915 WP_000160808.1.23945 WP_000160808.1.23950 WP_000160808.1.24024 WP_000160808.1.24045 WP_000160808.1.24068 WP_000160808.1.24089 WP_000160808.1.24122 WP_000160808.1.24136 WP_000160808.1.2418 WP_000160808.1.2430 WP_000160808.1.24304 WP_000160808.1.24316 WP_000160808.1.24362 WP_000160808.1.24374 WP_000160808.1.24381 WP_000160808.1.24383 WP_000160808.1.24460 WP_000160808.1.24473 WP_000160808.1.24483 WP_000160808.1.24485 WP_000160808.1.24536 WP_000160808.1.24575 WP_000160808.1.24583 WP_000160808.1.24642 WP_000160808.1.24646 WP_000160808.1.24650 WP_000160808.1.24693 WP_000160808.1.24695 WP_000160808.1.2479 WP_000160808.1.24849 WP_000160808.1.24876 WP_000160808.1.24899 WP_000160808.1.24929 WP_000160808.1.24939 WP_000160808.1.24946 WP_000160808.1.24960 WP_000160808.1.25019 WP_000160808.1.25039 WP_000160808.1.2504 WP_000160808.1.25085 WP_000160808.1.25086 WP_000160808.1.25087 WP_000160808.1.25141 WP_000160808.1.25183 WP_000160808.1.25203 WP_000160808.1.2531 WP_000160808.1.25312 WP_000160808.1.25324 WP_000160808.1.25378 WP_000160808.1.25414 WP_000160808.1.2543 WP_000160808.1.25525 WP_000160808.1.25548 WP_000160808.1.2558 WP_000160808.1.25592 WP_000160808.1.25613 WP_000160808.1.25631 WP_000160808.1.25726 WP_000160808.1.25755 WP_000160808.1.25843 WP_000160808.1.2588 WP_000160808.1.25886 WP_000160808.1.25945 WP_000160808.1.26048 WP_000160808.1.26055 WP_000160808.1.26061 WP_000160808.1.26100 WP_000160808.1.26130 WP_000160808.1.26150 WP_000160808.1.26161 WP_000160808.1.26186 WP_000160808.1.26191 WP_000160808.1.26264 WP_000160808.1.26270 WP_000160808.1.26325 WP_000160808.1.26331 WP_000160808.1.26379 WP_000160808.1.26391 WP_000160808.1.26401 WP_000160808.1.26403 WP_000160808.1.2642 WP_000160808.1.26479 WP_000160808.1.26517 WP_000160808.1.26569 WP_000160808.1.26588 WP_000160808.1.26598 WP_000160808.1.26609 WP_000160808.1.26613 WP_000160808.1.26644 WP_000160808.1.26683 WP_000160808.1.26716 WP_000160808.1.26720 WP_000160808.1.26912 WP_000160808.1.26941 WP_000160808.1.26943 WP_000160808.1.27019 WP_000160808.1.27060 WP_000160808.1.27098 WP_000160808.1.2712 WP_000160808.1.27134 WP_000160808.1.27141 WP_000160808.1.27175 WP_000160808.1.27234 WP_000160808.1.27260 WP_000160808.1.27280 WP_000160808.1.27283 WP_000160808.1.27287 WP_000160808.1.27292 WP_000160808.1.2731 WP_000160808.1.27310 WP_000160808.1.27330 WP_000160808.1.27367 WP_000160808.1.27424 WP_000160808.1.27504 WP_000160808.1.27524 WP_000160808.1.27580 WP_000160808.1.27611 WP_000160808.1.27691 WP_000160808.1.27698 WP_000160808.1.27723 WP_000160808.1.27741 WP_000160808.1.27742 WP_000160808.1.27749 WP_000160808.1.27758 WP_000160808.1.27856 WP_000160808.1.27876 WP_000160808.1.27897 WP_000160808.1.27971 WP_000160808.1.28109 WP_000160808.1.2811 WP_000160808.1.28110 WP_000160808.1.28128 WP_000160808.1.2826 WP_000160808.1.28268 WP_000160808.1.28271 WP_000160808.1.28305 WP_000160808.1.28401 WP_000160808.1.28480 WP_000160808.1.28509 WP_000160808.1.28523 WP_000160808.1.28540 WP_000160808.1.28544 WP_000160808.1.28662 WP_000160808.1.28683 WP_000160808.1.28711 WP_000160808.1.28760 WP_000160808.1.28809 WP_000160808.1.2881 WP_000160808.1.28919 WP_000160808.1.28950 WP_000160808.1.28953 WP_000160808.1.28982 WP_000160808.1.28994 WP_000160808.1.290 WP_000160808.1.29001 WP_000160808.1.29013 WP_000160808.1.29016 WP_000160808.1.29026 WP_000160808.1.29055 WP_000160808.1.29061 WP_000160808.1.29082 WP_000160808.1.29100 WP_000160808.1.29118 WP_000160808.1.29125 WP_000160808.1.29128 WP_000160808.1.29150 WP_000160808.1.29176 WP_000160808.1.29194 WP_000160808.1.29202 WP_000160808.1.29206 WP_000160808.1.29221 WP_000160808.1.2942 WP_000160808.1.2945 WP_000160808.1.29495 WP_000160808.1.29503 WP_000160808.1.29504 WP_000160808.1.2954 WP_000160808.1.29590 WP_000160808.1.29669 WP_000160808.1.29683 WP_000160808.1.29689 WP_000160808.1.29715 WP_000160808.1.29724 WP_000160808.1.29752 WP_000160808.1.29798 WP_000160808.1.29812 WP_000160808.1.29840 WP_000160808.1.29874 WP_000160808.1.29876 WP_000160808.1.2995 WP_000160808.1.29967 WP_000160808.1.29992 WP_000160808.1.30004 WP_000160808.1.30035 WP_000160808.1.30098 WP_000160808.1.30105 WP_000160808.1.30231 WP_000160808.1.30247 WP_000160808.1.30253 WP_000160808.1.30391 WP_000160808.1.30399 WP_000160808.1.30428 WP_000160808.1.30452 WP_000160808.1.30472 WP_000160808.1.30479 WP_000160808.1.30497 WP_000160808.1.30546 WP_000160808.1.30554 WP_000160808.1.30630 WP_000160808.1.30639 WP_000160808.1.30733 WP_000160808.1.30742 WP_000160808.1.30749 WP_000160808.1.30783 WP_000160808.1.30843 WP_000160808.1.30853 WP_000160808.1.30906 WP_000160808.1.31000 WP_000160808.1.31009 WP_000160808.1.31142 WP_000160808.1.31295 WP_000160808.1.31340 WP_000160808.1.31347 WP_000160808.1.31357 WP_000160808.1.31379 WP_000160808.1.31429 WP_000160808.1.31431 WP_000160808.1.31506 WP_000160808.1.31614 WP_000160808.1.31618 WP_000160808.1.31681 WP_000160808.1.3169 WP_000160808.1.31740 WP_000160808.1.31803 WP_000160808.1.31835 WP_000160808.1.31839 WP_000160808.1.31860 WP_000160808.1.31866 WP_000160808.1.31898 WP_000160808.1.31924 WP_000160808.1.3193 WP_000160808.1.31978 WP_000160808.1.32020 WP_000160808.1.32037 WP_000160808.1.32089 WP_000160808.1.32091 WP_000160808.1.32127 WP_000160808.1.32138 WP_000160808.1.32142 WP_000160808.1.32143 WP_000160808.1.3215 WP_000160808.1.32184 WP_000160808.1.32232 WP_000160808.1.32236 WP_000160808.1.32287 WP_000160808.1.32406 WP_000160808.1.32443 WP_000160808.1.3247 WP_000160808.1.32475 WP_000160808.1.32479 WP_000160808.1.3248 WP_000160808.1.32494 WP_000160808.1.32509 WP_000160808.1.32591 WP_000160808.1.32601 WP_000160808.1.32680 WP_000160808.1.32709 WP_000160808.1.32811 WP_000160808.1.32815 WP_000160808.1.32831 WP_000160808.1.32835 WP_000160808.1.32875 WP_000160808.1.32903 WP_000160808.1.32910 WP_000160808.1.32959 WP_000160808.1.32992 WP_000160808.1.32995 WP_000160808.1.33004 WP_000160808.1.33014 WP_000160808.1.33018 WP_000160808.1.33022 WP_000160808.1.33119 WP_000160808.1.33244 WP_000160808.1.33325 WP_000160808.1.33341 WP_000160808.1.33385 WP_000160808.1.33408 WP_000160808.1.33475 WP_000160808.1.33502 WP_000160808.1.33526 WP_000160808.1.3354 WP_000160808.1.33545 WP_000160808.1.33565 WP_000160808.1.33595 WP_000160808.1.33638 WP_000160808.1.33648 WP_000160808.1.33667 WP_000160808.1.33680 WP_000160808.1.33736 WP_000160808.1.33745 WP_000160808.1.33746 WP_000160808.1.33799 WP_000160808.1.33823 WP_000160808.1.33853 WP_000160808.1.33854 WP_000160808.1.33879 WP_000160808.1.33888 WP_000160808.1.33914 WP_000160808.1.33952 WP_000160808.1.33973 WP_000160808.1.34032 WP_000160808.1.34094 WP_000160808.1.34122 WP_000160808.1.342 WP_000160808.1.34206 WP_000160808.1.34270 WP_000160808.1.34273 WP_000160808.1.34277 WP_000160808.1.34332 WP_000160808.1.34341 WP_000160808.1.34363 WP_000160808.1.34397 WP_000160808.1.3444 WP_000160808.1.34444 WP_000160808.1.34464 WP_000160808.1.34525 WP_000160808.1.34532 WP_000160808.1.34605 WP_000160808.1.34682 WP_000160808.1.347 WP_000160808.1.34727 WP_000160808.1.34781 WP_000160808.1.34782 WP_000160808.1.34794 WP_000160808.1.34855 WP_000160808.1.34948 WP_000160808.1.34990 WP_000160808.1.35006 WP_000160808.1.35114 WP_000160808.1.35202 WP_000160808.1.35204 WP_000160808.1.35211 WP_000160808.1.35316 WP_000160808.1.35360 WP_000160808.1.35365 WP_000160808.1.35376 WP_000160808.1.3539 WP_000160808.1.35464 WP_000160808.1.35465 WP_000160808.1.35466 WP_000160808.1.35468 WP_000160808.1.35552 WP_000160808.1.3560 WP_000160808.1.35651 WP_000160808.1.35653 WP_000160808.1.35704 WP_000160808.1.35724 WP_000160808.1.35904 WP_000160808.1.35922 WP_000160808.1.35927 WP_000160808.1.35934 WP_000160808.1.35942 WP_000160808.1.35959 WP_000160808.1.36042 WP_000160808.1.36070 WP_000160808.1.36071 WP_000160808.1.36085 WP_000160808.1.36094 WP_000160808.1.36164 WP_000160808.1.36166 WP_000160808.1.36177 WP_000160808.1.36182 WP_000160808.1.3620 WP_000160808.1.36332 WP_000160808.1.36334 WP_000160808.1.36386 WP_000160808.1.36393 WP_000160808.1.36412 WP_000160808.1.36453 WP_000160808.1.36496 WP_000160808.1.36500 WP_000160808.1.36507 WP_000160808.1.36523 WP_000160808.1.36610 WP_000160808.1.36627 WP_000160808.1.36628 WP_000160808.1.36707 WP_000160808.1.3671 WP_000160808.1.36739 WP_000160808.1.36746 WP_000160808.1.36747 WP_000160808.1.36812 WP_000160808.1.36817 WP_000160808.1.36826 WP_000160808.1.36833 WP_000160808.1.36925 WP_000160808.1.36975 WP_000160808.1.37020 WP_000160808.1.37046 WP_000160808.1.37057 WP_000160808.1.37099 WP_000160808.1.37122 WP_000160808.1.37206 WP_000160808.1.37233 WP_000160808.1.37252 WP_000160808.1.37329 WP_000160808.1.37334 WP_000160808.1.37352 WP_000160808.1.37371 WP_000160808.1.37433 WP_000160808.1.37445 WP_000160808.1.37476 WP_000160808.1.37485 WP_000160808.1.37554 WP_000160808.1.37576 WP_000160808.1.37634 WP_000160808.1.377 WP_000160808.1.3772 WP_000160808.1.37745 WP_000160808.1.37758 WP_000160808.1.37762 WP_000160808.1.37773 WP_000160808.1.37817 WP_000160808.1.37852 WP_000160808.1.3788 WP_000160808.1.37880 WP_000160808.1.37887 WP_000160808.1.37897 WP_000160808.1.37917 WP_000160808.1.37926 WP_000160808.1.37964 WP_000160808.1.37995 WP_000160808.1.38033 WP_000160808.1.38081 WP_000160808.1.38103 WP_000160808.1.38120 WP_000160808.1.3815 WP_000160808.1.38155 WP_000160808.1.38162 WP_000160808.1.38182 WP_000160808.1.38211 WP_000160808.1.38257 WP_000160808.1.38314 WP_000160808.1.38371 WP_000160808.1.38412 WP_000160808.1.38485 WP_000160808.1.38584 WP_000160808.1.38626 WP_000160808.1.38629 WP_000160808.1.38694 WP_000160808.1.38722 WP_000160808.1.3873 WP_000160808.1.38777 WP_000160808.1.38782 WP_000160808.1.38811 WP_000160808.1.38896 WP_000160808.1.38911 WP_000160808.1.38920 WP_000160808.1.38935 WP_000160808.1.38950 WP_000160808.1.38956 WP_000160808.1.39005 WP_000160808.1.3904 WP_000160808.1.39042 WP_000160808.1.39103 WP_000160808.1.39123 WP_000160808.1.39150 WP_000160808.1.39164 WP_000160808.1.39167 WP_000160808.1.39171 WP_000160808.1.39249 WP_000160808.1.39305 WP_000160808.1.39342 WP_000160808.1.39356 WP_000160808.1.39367 WP_000160808.1.39430 WP_000160808.1.39481 WP_000160808.1.39509 WP_000160808.1.39531 WP_000160808.1.3954 WP_000160808.1.39606 WP_000160808.1.39607 WP_000160808.1.39610 WP_000160808.1.39636 WP_000160808.1.39690 WP_000160808.1.39758 WP_000160808.1.39780 WP_000160808.1.39818 WP_000160808.1.39822 WP_000160808.1.39829 WP_000160808.1.39870 WP_000160808.1.39938 WP_000160808.1.39961 WP_000160808.1.39966 WP_000160808.1.39992 WP_000160808.1.39998 WP_000160808.1.40013 WP_000160808.1.40016 WP_000160808.1.40088 WP_000160808.1.40147 WP_000160808.1.4020 WP_000160808.1.40206 WP_000160808.1.40212 WP_000160808.1.40218 WP_000160808.1.40238 WP_000160808.1.40249 WP_000160808.1.40315 WP_000160808.1.40319 WP_000160808.1.40335 WP_000160808.1.40382 WP_000160808.1.40391 WP_000160808.1.40403 WP_000160808.1.4049 WP_000160808.1.40499 WP_000160808.1.40502 WP_000160808.1.40509 WP_000160808.1.40524 WP_000160808.1.40563 WP_000160808.1.40596 WP_000160808.1.40599 WP_000160808.1.406 WP_000160808.1.40617 WP_000160808.1.40686 WP_000160808.1.40712 WP_000160808.1.40781 WP_000160808.1.40813 WP_000160808.1.40815 WP_000160808.1.4082 WP_000160808.1.40833 WP_000160808.1.40865 WP_000160808.1.40898 WP_000160808.1.40912 WP_000160808.1.40937 WP_000160808.1.40965 WP_000160808.1.41037 WP_000160808.1.41045 WP_000160808.1.41125 WP_000160808.1.41147 WP_000160808.1.41206 WP_000160808.1.41239 WP_000160808.1.4126 WP_000160808.1.41263 WP_000160808.1.41287 WP_000160808.1.41315 WP_000160808.1.41346 WP_000160808.1.41363 WP_000160808.1.41368 WP_000160808.1.41371 WP_000160808.1.41402 WP_000160808.1.41407 WP_000160808.1.41417 WP_000160808.1.4142 WP_000160808.1.41436 WP_000160808.1.41455 WP_000160808.1.41466 WP_000160808.1.41484 WP_000160808.1.41530 WP_000160808.1.41545 WP_000160808.1.41556 WP_000160808.1.41566 WP_000160808.1.41613 WP_000160808.1.41621 WP_000160808.1.41651 WP_000160808.1.41654 WP_000160808.1.41712 WP_000160808.1.4172 WP_000160808.1.41740 WP_000160808.1.41752 WP_000160808.1.41782 WP_000160808.1.41784 WP_000160808.1.41812 WP_000160808.1.41960 WP_000160808.1.41988 WP_000160808.1.42022 WP_000160808.1.42033 WP_000160808.1.42038 WP_000160808.1.42060 WP_000160808.1.42073 WP_000160808.1.42113 WP_000160808.1.42138 WP_000160808.1.4214 WP_000160808.1.42159 WP_000160808.1.42179 WP_000160808.1.42203 WP_000160808.1.42209 WP_000160808.1.42214 WP_000160808.1.42233 WP_000160808.1.4224 WP_000160808.1.42252 WP_000160808.1.42318 WP_000160808.1.42367 WP_000160808.1.42376 WP_000160808.1.42387 WP_000160808.1.42415 WP_000160808.1.4242 WP_000160808.1.42432 WP_000160808.1.42442 WP_000160808.1.42480 WP_000160808.1.42522 WP_000160808.1.42632 WP_000160808.1.42661 WP_000160808.1.42669 WP_000160808.1.42748 WP_000160808.1.42749 WP_000160808.1.42813 WP_000160808.1.42832 WP_000160808.1.42879 WP_000160808.1.42891 WP_000160808.1.4290 WP_000160808.1.42918 WP_000160808.1.42936 WP_000160808.1.42937 WP_000160808.1.42950 WP_000160808.1.42962 WP_000160808.1.42987 WP_000160808.1.4306 WP_000160808.1.43132 WP_000160808.1.43137 WP_000160808.1.43166 WP_000160808.1.43174 WP_000160808.1.43177 WP_000160808.1.43239 WP_000160808.1.43270 WP_000160808.1.43316 WP_000160808.1.43363 WP_000160808.1.4342 WP_000160808.1.43455 WP_000160808.1.43473 WP_000160808.1.43474 WP_000160808.1.43598 WP_000160808.1.43642 WP_000160808.1.43720 WP_000160808.1.43750 WP_000160808.1.43804 WP_000160808.1.43925 WP_000160808.1.44018 WP_000160808.1.44020 WP_000160808.1.44029 WP_000160808.1.44040 WP_000160808.1.44077 WP_000160808.1.44088 WP_000160808.1.44100 WP_000160808.1.4415 WP_000160808.1.44166 WP_000160808.1.44201 WP_000160808.1.44238 WP_000160808.1.44273 WP_000160808.1.44285 WP_000160808.1.44292 WP_000160808.1.44445 WP_000160808.1.44458 WP_000160808.1.4449 WP_000160808.1.44558 WP_000160808.1.44570 WP_000160808.1.44587 WP_000160808.1.44608 WP_000160808.1.44724 WP_000160808.1.4473 WP_000160808.1.44756 WP_000160808.1.44821 WP_000160808.1.44854 WP_000160808.1.44857 WP_000160808.1.44923 WP_000160808.1.44961 WP_000160808.1.44980 WP_000160808.1.45028 WP_000160808.1.45043 WP_000160808.1.45053 WP_000160808.1.4516 WP_000160808.1.45208 WP_000160808.1.45246 WP_000160808.1.45301 WP_000160808.1.45329 WP_000160808.1.45359 WP_000160808.1.45444 WP_000160808.1.4549 WP_000160808.1.45581 WP_000160808.1.45595 WP_000160808.1.45600 WP_000160808.1.4570 WP_000160808.1.45741 WP_000160808.1.45840 WP_000160808.1.45865 WP_000160808.1.45868 WP_000160808.1.4593 WP_000160808.1.45930 WP_000160808.1.45945 WP_000160808.1.45960 WP_000160808.1.45968 WP_000160808.1.4600 WP_000160808.1.46026 WP_000160808.1.46027 WP_000160808.1.46048 WP_000160808.1.46070 WP_000160808.1.46081 WP_000160808.1.46097 WP_000160808.1.46105 WP_000160808.1.46115 WP_000160808.1.4613 WP_000160808.1.46186 WP_000160808.1.46197 WP_000160808.1.46213 WP_000160808.1.46239 WP_000160808.1.46257 WP_000160808.1.46325 WP_000160808.1.46329 WP_000160808.1.46433 WP_000160808.1.46477 WP_000160808.1.46526 WP_000160808.1.46552 WP_000160808.1.46555 WP_000160808.1.46573 WP_000160808.1.46582 WP_000160808.1.46602 WP_000160808.1.46614 WP_000160808.1.46616 WP_000160808.1.46643 WP_000160808.1.46668 WP_000160808.1.4670 WP_000160808.1.46743 WP_000160808.1.46820 WP_000160808.1.46821 WP_000160808.1.46860 WP_000160808.1.46876 WP_000160808.1.46882 WP_000160808.1.46898 WP_000160808.1.46909 WP_000160808.1.4691 WP_000160808.1.46912 WP_000160808.1.46932 WP_000160808.1.46990 WP_000160808.1.46999 WP_000160808.1.47028 WP_000160808.1.47034 WP_000160808.1.47038 WP_000160808.1.47050 WP_000160808.1.47063 WP_000160808.1.47069 WP_000160808.1.47156 WP_000160808.1.47224 WP_000160808.1.47246 WP_000160808.1.47280 WP_000160808.1.47307 WP_000160808.1.47319 WP_000160808.1.47356 WP_000160808.1.47363 WP_000160808.1.47370 WP_000160808.1.47386 WP_000160808.1.47398 WP_000160808.1.4740 WP_000160808.1.47401 WP_000160808.1.47414 WP_000160808.1.47425 WP_000160808.1.47473 WP_000160808.1.47477 WP_000160808.1.47496 WP_000160808.1.47529 WP_000160808.1.47555 WP_000160808.1.47646 WP_000160808.1.47662 WP_000160808.1.47673 WP_000160808.1.4772 WP_000160808.1.47744 WP_000160808.1.47761 WP_000160808.1.47764 WP_000160808.1.47765 WP_000160808.1.47770 WP_000160808.1.47820 WP_000160808.1.4785 WP_000160808.1.4796 WP_000160808.1.47962 WP_000160808.1.47976 WP_000160808.1.48000 WP_000160808.1.48018 WP_000160808.1.48040 WP_000160808.1.48073 WP_000160808.1.48077 WP_000160808.1.48080 WP_000160808.1.48096 WP_000160808.1.48111 WP_000160808.1.48144 WP_000160808.1.48222 WP_000160808.1.48290 WP_000160808.1.48353 WP_000160808.1.48355 WP_000160808.1.48421 WP_000160808.1.48433 WP_000160808.1.48480 WP_000160808.1.48483 WP_000160808.1.48505 WP_000160808.1.48522 WP_000160808.1.4857 WP_000160808.1.48571 WP_000160808.1.486 WP_000160808.1.48615 WP_000160808.1.48678 WP_000160808.1.48771 WP_000160808.1.48801 WP_000160808.1.48847 WP_000160808.1.48860 WP_000160808.1.48901 WP_000160808.1.48921 WP_000160808.1.48926 WP_000160808.1.48928 WP_000160808.1.48954 WP_000160808.1.48970 WP_000160808.1.49009 WP_000160808.1.49107 WP_000160808.1.49124 WP_000160808.1.49147 WP_000160808.1.49190 WP_000160808.1.49229 WP_000160808.1.49243 WP_000160808.1.49312 WP_000160808.1.49336 WP_000160808.1.49363 WP_000160808.1.49459 WP_000160808.1.49481 WP_000160808.1.49482 WP_000160808.1.4949 WP_000160808.1.49546 WP_000160808.1.49558 WP_000160808.1.49621 WP_000160808.1.49645 WP_000160808.1.49661 WP_000160808.1.49722 WP_000160808.1.49733 WP_000160808.1.49740 WP_000160808.1.49768 WP_000160808.1.49774 WP_000160808.1.49856 WP_000160808.1.49861 WP_000160808.1.49879 WP_000160808.1.49883 WP_000160808.1.49950 WP_000160808.1.49954 WP_000160808.1.49987 WP_000160808.1.50008 WP_000160808.1.50036 WP_000160808.1.50113 WP_000160808.1.50119 WP_000160808.1.5017 WP_000160808.1.50182 WP_000160808.1.50207 WP_000160808.1.50258 WP_000160808.1.50262 WP_000160808.1.50269 WP_000160808.1.50353 WP_000160808.1.50361 WP_000160808.1.50366 WP_000160808.1.50412 WP_000160808.1.50418 WP_000160808.1.50452 WP_000160808.1.50579 WP_000160808.1.50616 WP_000160808.1.5067 WP_000160808.1.50715 WP_000160808.1.50725 WP_000160808.1.50939 WP_000160808.1.5095 WP_000160808.1.50969 WP_000160808.1.50996 WP_000160808.1.51013 WP_000160808.1.51042 WP_000160808.1.5106 WP_000160808.1.51109 WP_000160808.1.51172 WP_000160808.1.51175 WP_000160808.1.51248 WP_000160808.1.51260 WP_000160808.1.51278 WP_000160808.1.5128 WP_000160808.1.51299 WP_000160808.1.51323 WP_000160808.1.51380 WP_000160808.1.51405 WP_000160808.1.51427 WP_000160808.1.51430 WP_000160808.1.5146 WP_000160808.1.51462 WP_000160808.1.51490 WP_000160808.1.51495 WP_000160808.1.51537 WP_000160808.1.51539 WP_000160808.1.51548 WP_000160808.1.5157 WP_000160808.1.51580 WP_000160808.1.51587 WP_000160808.1.51629 WP_000160808.1.51707 WP_000160808.1.51784 WP_000160808.1.51837 WP_000160808.1.51839 WP_000160808.1.51873 WP_000160808.1.51899 WP_000160808.1.51968 WP_000160808.1.51985 WP_000160808.1.51988 WP_000160808.1.51999 WP_000160808.1.52076 WP_000160808.1.52127 WP_000160808.1.52171 WP_000160808.1.52186 WP_000160808.1.52200 WP_000160808.1.52211 WP_000160808.1.52214 WP_000160808.1.52243 WP_000160808.1.52249 WP_000160808.1.5227 WP_000160808.1.52272 WP_000160808.1.52305 WP_000160808.1.52378 WP_000160808.1.5239 WP_000160808.1.52399 WP_000160808.1.52419 WP_000160808.1.52421 WP_000160808.1.52492 WP_000160808.1.52524 WP_000160808.1.52544 WP_000160808.1.52612 WP_000160808.1.5265 WP_000160808.1.52662 WP_000160808.1.52691 WP_000160808.1.52710 WP_000160808.1.52735 WP_000160808.1.52762 WP_000160808.1.52774 WP_000160808.1.52777 WP_000160808.1.52780 WP_000160808.1.52844 WP_000160808.1.52846 WP_000160808.1.52852 WP_000160808.1.52853 WP_000160808.1.52881 WP_000160808.1.52908 WP_000160808.1.52913 WP_000160808.1.52962 WP_000160808.1.53027 WP_000160808.1.53065 WP_000160808.1.53095 WP_000160808.1.5310 WP_000160808.1.53110 WP_000160808.1.53155 WP_000160808.1.532 WP_000160808.1.53223 WP_000160808.1.53238 WP_000160808.1.53242 WP_000160808.1.53251 WP_000160808.1.53262 WP_000160808.1.53327 WP_000160808.1.53364 WP_000160808.1.53401 WP_000160808.1.5342 WP_000160808.1.53428 WP_000160808.1.53505 WP_000160808.1.53592 WP_000160808.1.53594 WP_000160808.1.5362 WP_000160808.1.53642 WP_000160808.1.53645 WP_000160808.1.53706 WP_000160808.1.53809 WP_000160808.1.53866 WP_000160808.1.53931 WP_000160808.1.53966 WP_000160808.1.53972 WP_000160808.1.53994 WP_000160808.1.54002 WP_000160808.1.54013 WP_000160808.1.54023 WP_000160808.1.54028 WP_000160808.1.54072 WP_000160808.1.54091 WP_000160808.1.54144 WP_000160808.1.54169 WP_000160808.1.54185 WP_000160808.1.54263 WP_000160808.1.54307 WP_000160808.1.54317 WP_000160808.1.54328 WP_000160808.1.54329 WP_000160808.1.54344 WP_000160808.1.54359 WP_000160808.1.54463 WP_000160808.1.54476 WP_000160808.1.54507 WP_000160808.1.54546 WP_000160808.1.54591 WP_000160808.1.5460 WP_000160808.1.54602 WP_000160808.1.54605 WP_000160808.1.54617 WP_000160808.1.54620 WP_000160808.1.54638 WP_000160808.1.54688 WP_000160808.1.54695 WP_000160808.1.5470 WP_000160808.1.54708 WP_000160808.1.54725 WP_000160808.1.54729 WP_000160808.1.5479 WP_000160808.1.54798 WP_000160808.1.54829 WP_000160808.1.54918 WP_000160808.1.54941 WP_000160808.1.54981 WP_000160808.1.54991 WP_000160808.1.55003 WP_000160808.1.55005 WP_000160808.1.55009 WP_000160808.1.55041 WP_000160808.1.55112 WP_000160808.1.55115 WP_000160808.1.55123 WP_000160808.1.55134 WP_000160808.1.55144 WP_000160808.1.55197 WP_000160808.1.5520 WP_000160808.1.55203 WP_000160808.1.55222 WP_000160808.1.55226 WP_000160808.1.55338 WP_000160808.1.55342 WP_000160808.1.55357 WP_000160808.1.55381 WP_000160808.1.55417 WP_000160808.1.55424 WP_000160808.1.55425 WP_000160808.1.55466 WP_000160808.1.55489 WP_000160808.1.55529 WP_000160808.1.55551 WP_000160808.1.55552 WP_000160808.1.55560 WP_000160808.1.55571 WP_000160808.1.55574 WP_000160808.1.55597 WP_000160808.1.55608 WP_000160808.1.5561 WP_000160808.1.55676 WP_000160808.1.5570 WP_000160808.1.55709 WP_000160808.1.55720 WP_000160808.1.55730 WP_000160808.1.55757 WP_000160808.1.55787 WP_000160808.1.55844 WP_000160808.1.55868 WP_000160808.1.561 WP_000160808.1.56149 WP_000160808.1.5616 WP_000160808.1.56193 WP_000160808.1.56197 WP_000160808.1.56216 WP_000160808.1.56285 WP_000160808.1.56302 WP_000160808.1.56371 WP_000160808.1.56390 WP_000160808.1.56399 WP_000160808.1.56439 WP_000160808.1.5646 WP_000160808.1.56513 WP_000160808.1.56528 WP_000160808.1.56543 WP_000160808.1.56665 WP_000160808.1.56680 WP_000160808.1.56689 WP_000160808.1.5670 WP_000160808.1.56704 WP_000160808.1.56721 WP_000160808.1.56786 WP_000160808.1.56789 WP_000160808.1.56799 WP_000160808.1.56830 WP_000160808.1.56835 WP_000160808.1.56871 WP_000160808.1.56882 WP_000160808.1.57072 WP_000160808.1.57086 WP_000160808.1.57100 WP_000160808.1.57181 WP_000160808.1.57216 WP_000160808.1.57222 WP_000160808.1.57281 WP_000160808.1.57386 WP_000160808.1.57401 WP_000160808.1.57403 WP_000160808.1.57410 WP_000160808.1.57432 WP_000160808.1.5748 WP_000160808.1.57487 WP_000160808.1.57538 WP_000160808.1.5755 WP_000160808.1.57558 WP_000160808.1.57629 WP_000160808.1.57638 WP_000160808.1.57659 WP_000160808.1.57719 WP_000160808.1.57738 WP_000160808.1.57812 WP_000160808.1.57846 WP_000160808.1.5786 WP_000160808.1.57920 WP_000160808.1.58001 WP_000160808.1.58022 WP_000160808.1.58045 WP_000160808.1.58060 WP_000160808.1.5810 WP_000160808.1.58128 WP_000160808.1.58143 WP_000160808.1.58163 WP_000160808.1.58172 WP_000160808.1.58226 WP_000160808.1.58232 WP_000160808.1.58267 WP_000160808.1.58289 WP_000160808.1.58316 WP_000160808.1.58371 WP_000160808.1.58384 WP_000160808.1.58429 WP_000160808.1.58440 WP_000160808.1.58445 WP_000160808.1.58507 WP_000160808.1.58514 WP_000160808.1.58528 WP_000160808.1.58547 WP_000160808.1.58572 WP_000160808.1.58582 WP_000160808.1.58622 WP_000160808.1.58705 WP_000160808.1.58837 WP_000160808.1.58867 WP_000160808.1.58870 WP_000160808.1.58940 WP_000160808.1.58983 WP_000160808.1.59024 WP_000160808.1.59026 WP_000160808.1.59035 WP_000160808.1.5906 WP_000160808.1.59083 WP_000160808.1.59119 WP_000160808.1.59174 WP_000160808.1.59190 WP_000160808.1.59199 WP_000160808.1.59280 WP_000160808.1.59293 WP_000160808.1.59302 WP_000160808.1.59395 WP_000160808.1.59407 WP_000160808.1.59413 WP_000160808.1.59423 WP_000160808.1.59434 WP_000160808.1.59513 WP_000160808.1.59590 WP_000160808.1.59615 WP_000160808.1.59621 WP_000160808.1.5965 WP_000160808.1.59699 WP_000160808.1.59717 WP_000160808.1.59730 WP_000160808.1.59737 WP_000160808.1.59756 WP_000160808.1.59781 WP_000160808.1.59782 WP_000160808.1.59823 WP_000160808.1.59836 WP_000160808.1.59877 WP_000160808.1.59912 WP_000160808.1.59989 WP_000160808.1.59998 WP_000160808.1.6002 WP_000160808.1.60031 WP_000160808.1.60067 WP_000160808.1.60070 WP_000160808.1.60095 WP_000160808.1.6022 WP_000160808.1.60228 WP_000160808.1.60325 WP_000160808.1.60343 WP_000160808.1.60387 WP_000160808.1.60436 WP_000160808.1.60491 WP_000160808.1.60498 WP_000160808.1.60550 WP_000160808.1.60567 WP_000160808.1.60576 WP_000160808.1.6059 WP_000160808.1.60606 WP_000160808.1.6061 WP_000160808.1.6064 WP_000160808.1.60698 WP_000160808.1.60732 WP_000160808.1.60764 WP_000160808.1.60835 WP_000160808.1.60895 WP_000160808.1.60901 WP_000160808.1.60927 WP_000160808.1.61005 WP_000160808.1.61058 WP_000160808.1.61096 WP_000160808.1.6110 WP_000160808.1.61102 WP_000160808.1.61112 WP_000160808.1.61170 WP_000160808.1.61174 WP_000160808.1.61225 WP_000160808.1.61241 WP_000160808.1.61292 WP_000160808.1.61398 WP_000160808.1.61505 WP_000160808.1.61512 WP_000160808.1.61517 WP_000160808.1.61551 WP_000160808.1.61608 WP_000160808.1.61636 WP_000160808.1.61663 WP_000160808.1.61758 WP_000160808.1.61770 WP_000160808.1.61779 WP_000160808.1.61806 WP_000160808.1.61822 WP_000160808.1.61858 WP_000160808.1.61926 WP_000160808.1.61939 WP_000160808.1.62041 WP_000160808.1.62099 WP_000160808.1.6212 WP_000160808.1.62290 WP_000160808.1.62296 WP_000160808.1.62337 WP_000160808.1.62358 WP_000160808.1.62447 WP_000160808.1.62460 WP_000160808.1.62487 WP_000160808.1.62514 WP_000160808.1.62529 WP_000160808.1.62612 WP_000160808.1.62646 WP_000160808.1.62668 WP_000160808.1.62681 WP_000160808.1.62735 WP_000160808.1.62750 WP_000160808.1.62762 WP_000160808.1.62769 WP_000160808.1.62787 WP_000160808.1.62812 WP_000160808.1.62818 WP_000160808.1.62850 WP_000160808.1.62851 WP_000160808.1.62919 WP_000160808.1.6293 WP_000160808.1.62931 WP_000160808.1.62959 WP_000160808.1.62973 WP_000160808.1.62989 WP_000160808.1.6299 WP_000160808.1.63177 WP_000160808.1.63189 WP_000160808.1.63246 WP_000160808.1.63287 WP_000160808.1.6337 WP_000160808.1.63370 WP_000160808.1.63374 WP_000160808.1.63393 WP_000160808.1.63437 WP_000160808.1.63466 WP_000160808.1.63467 WP_000160808.1.63470 WP_000160808.1.63478 WP_000160808.1.63484 WP_000160808.1.63491 WP_000160808.1.63536 WP_000160808.1.63556 WP_000160808.1.63576 WP_000160808.1.63666 WP_000160808.1.63679 WP_000160808.1.63703 WP_000160808.1.63746 WP_000160808.1.63821 WP_000160808.1.63964 WP_000160808.1.64008 WP_000160808.1.64014 WP_000160808.1.64050 WP_000160808.1.64074 WP_000160808.1.64150 WP_000160808.1.6416 WP_000160808.1.64175 WP_000160808.1.64193 WP_000160808.1.64286 WP_000160808.1.64321 WP_000160808.1.64337 WP_000160808.1.64355 WP_000160808.1.64356 WP_000160808.1.64380 WP_000160808.1.64391 WP_000160808.1.6441 WP_000160808.1.64438 WP_000160808.1.64448 WP_000160808.1.64458 WP_000160808.1.64528 WP_000160808.1.64657 WP_000160808.1.64693 WP_000160808.1.647 WP_000160808.1.64707 WP_000160808.1.64746 WP_000160808.1.64749 WP_000160808.1.64784 WP_000160808.1.64789 WP_000160808.1.64881 WP_000160808.1.64912 WP_000160808.1.64926 WP_000160808.1.64970 WP_000160808.1.65023 WP_000160808.1.65040 WP_000160808.1.65097 WP_000160808.1.651 WP_000160808.1.65151 WP_000160808.1.65155 WP_000160808.1.65179 WP_000160808.1.65206 WP_000160808.1.65305 WP_000160808.1.65306 WP_000160808.1.65353 WP_000160808.1.65364 WP_000160808.1.6537 WP_000160808.1.65370 WP_000160808.1.654 WP_000160808.1.65408 WP_000160808.1.65413 WP_000160808.1.65415 WP_000160808.1.65493 WP_000160808.1.65531 WP_000160808.1.65672 WP_000160808.1.65708 WP_000160808.1.65762 WP_000160808.1.65912 WP_000160808.1.65962 WP_000160808.1.6599 WP_000160808.1.66001 WP_000160808.1.6604 WP_000160808.1.66050 WP_000160808.1.66094 WP_000160808.1.66104 WP_000160808.1.66105 WP_000160808.1.66127 WP_000160808.1.66181 WP_000160808.1.66197 WP_000160808.1.66288 WP_000160808.1.66327 WP_000160808.1.6635 WP_000160808.1.66389 WP_000160808.1.66395 WP_000160808.1.66412 WP_000160808.1.6645 WP_000160808.1.66501 WP_000160808.1.6654 WP_000160808.1.66550 WP_000160808.1.66579 WP_000160808.1.66624 WP_000160808.1.66644 WP_000160808.1.6665 WP_000160808.1.66700 WP_000160808.1.66719 WP_000160808.1.66758 WP_000160808.1.66783 WP_000160808.1.66849 WP_000160808.1.66926 WP_000160808.1.66933 WP_000160808.1.66948 WP_000160808.1.67018 WP_000160808.1.67022 WP_000160808.1.67026 WP_000160808.1.67102 WP_000160808.1.67120 WP_000160808.1.67137 WP_000160808.1.67194 WP_000160808.1.67200 WP_000160808.1.6723 WP_000160808.1.67272 WP_000160808.1.67293 WP_000160808.1.6735 WP_000160808.1.67383 WP_000160808.1.67415 WP_000160808.1.67454 WP_000160808.1.67468 WP_000160808.1.67522 WP_000160808.1.67538 WP_000160808.1.67549 WP_000160808.1.67553 WP_000160808.1.67581 WP_000160808.1.67663 WP_000160808.1.67701 WP_000160808.1.67724 WP_000160808.1.67732 WP_000160808.1.67786 WP_000160808.1.67787 WP_000160808.1.67788 WP_000160808.1.678 WP_000160808.1.67841 WP_000160808.1.67861 WP_000160808.1.67975 WP_000160808.1.67999 WP_000160808.1.68008 WP_000160808.1.6802 WP_000160808.1.68025 WP_000160808.1.6803 WP_000160808.1.68079 WP_000160808.1.68170 WP_000160808.1.68175 WP_000160808.1.682 WP_000160808.1.68215 WP_000160808.1.68241 WP_000160808.1.68255 WP_000160808.1.68300 WP_000160808.1.68336 WP_000160808.1.68341 WP_000160808.1.68347 WP_000160808.1.68442 WP_000160808.1.68534 WP_000160808.1.68566 WP_000160808.1.6860 WP_000160808.1.68609 WP_000160808.1.68673 WP_000160808.1.68678 WP_000160808.1.68697 WP_000160808.1.68751 WP_000160808.1.68801 WP_000160808.1.68865 WP_000160808.1.68915 WP_000160808.1.68956 WP_000160808.1.68989 WP_000160808.1.69033 WP_000160808.1.69098 WP_000160808.1.69126 WP_000160808.1.69127 WP_000160808.1.69144 WP_000160808.1.6916 WP_000160808.1.69258 WP_000160808.1.69261 WP_000160808.1.69303 WP_000160808.1.69390 WP_000160808.1.694 WP_000160808.1.6945 WP_000160808.1.69472 WP_000160808.1.69551 WP_000160808.1.69589 WP_000160808.1.69593 WP_000160808.1.69646 WP_000160808.1.69689 WP_000160808.1.69786 WP_000160808.1.69887 WP_000160808.1.69972 WP_000160808.1.70063 WP_000160808.1.70149 WP_000160808.1.70213 WP_000160808.1.70357 WP_000160808.1.70370 WP_000160808.1.70407 WP_000160808.1.70414 WP_000160808.1.70477 WP_000160808.1.70492 WP_000160808.1.7052 WP_000160808.1.70578 WP_000160808.1.70582 WP_000160808.1.70592 WP_000160808.1.70628 WP_000160808.1.70694 WP_000160808.1.70745 WP_000160808.1.70748 WP_000160808.1.70767 WP_000160808.1.70801 WP_000160808.1.70803 WP_000160808.1.70880 WP_000160808.1.7090 WP_000160808.1.70900 WP_000160808.1.70967 WP_000160808.1.71042 WP_000160808.1.71062 WP_000160808.1.71109 WP_000160808.1.71113 WP_000160808.1.71134 WP_000160808.1.71147 WP_000160808.1.71159 WP_000160808.1.71162 WP_000160808.1.71192 WP_000160808.1.71199 WP_000160808.1.71221 WP_000160808.1.71229 WP_000160808.1.71272 WP_000160808.1.71312 WP_000160808.1.71323 WP_000160808.1.71327 WP_000160808.1.71339 WP_000160808.1.71354 WP_000160808.1.71397 WP_000160808.1.71403 WP_000160808.1.71409 WP_000160808.1.71480 WP_000160808.1.71537 WP_000160808.1.71540 WP_000160808.1.71603 WP_000160808.1.71632 WP_000160808.1.71680 WP_000160808.1.71690 WP_000160808.1.71767 WP_000160808.1.71783 WP_000160808.1.71837 WP_000160808.1.71856 WP_000160808.1.71874 WP_000160808.1.7192 WP_000160808.1.71938 WP_000160808.1.71944 WP_000160808.1.71987 WP_000160808.1.71993 WP_000160808.1.72013 WP_000160808.1.72021 WP_000160808.1.72033 WP_000160808.1.7205 WP_000160808.1.72053 WP_000160808.1.7210 WP_000160808.1.72125 WP_000160808.1.72141 WP_000160808.1.72153 WP_000160808.1.72184 WP_000160808.1.7225 WP_000160808.1.72261 WP_000160808.1.72270 WP_000160808.1.72279 WP_000160808.1.72431 WP_000160808.1.72485 WP_000160808.1.72493 WP_000160808.1.72521 WP_000160808.1.72522 WP_000160808.1.72535 WP_000160808.1.72582 WP_000160808.1.72606 WP_000160808.1.72608 WP_000160808.1.72616 WP_000160808.1.72643 WP_000160808.1.72652 WP_000160808.1.72663 WP_000160808.1.72725 WP_000160808.1.72729 WP_000160808.1.72747 WP_000160808.1.72751 WP_000160808.1.72758 WP_000160808.1.72764 WP_000160808.1.72858 WP_000160808.1.72860 WP_000160808.1.72869 WP_000160808.1.73010 WP_000160808.1.73032 WP_000160808.1.7307 WP_000160808.1.73072 WP_000160808.1.73129 WP_000160808.1.73197 WP_000160808.1.73217 WP_000160808.1.73239 WP_000160808.1.73249 WP_000160808.1.73251 WP_000160808.1.73257 WP_000160808.1.73259 WP_000160808.1.73295 WP_000160808.1.73326 WP_000160808.1.73340 WP_000160808.1.73349 WP_000160808.1.73468 WP_000160808.1.7349 WP_000160808.1.73524 WP_000160808.1.73604 WP_000160808.1.73663 WP_000160808.1.73700 WP_000160808.1.73709 WP_000160808.1.73717 WP_000160808.1.73743 WP_000160808.1.73797 WP_000160808.1.73827 WP_000160808.1.73835 WP_000160808.1.73843 WP_000160808.1.73844 WP_000160808.1.73882 WP_000160808.1.73897 WP_000160808.1.73908 WP_000160808.1.73942 WP_000160808.1.73992 WP_000160808.1.73995 WP_000160808.1.73996 WP_000160808.1.74051 WP_000160808.1.7411 WP_000160808.1.7413 WP_000160808.1.74156 WP_000160808.1.74184 WP_000160808.1.7424 WP_000160808.1.7425 WP_000160808.1.74365 WP_000160808.1.74423 WP_000160808.1.74431 WP_000160808.1.74444 WP_000160808.1.74445 WP_000160808.1.74478 WP_000160808.1.74491 WP_000160808.1.74501 WP_000160808.1.74513 WP_000160808.1.74520 WP_000160808.1.74528 WP_000160808.1.74532 WP_000160808.1.74624 WP_000160808.1.74625 WP_000160808.1.74652 WP_000160808.1.74670 WP_000160808.1.74687 WP_000160808.1.74688 WP_000160808.1.74689 WP_000160808.1.74691 WP_000160808.1.74705 WP_000160808.1.74713 WP_000160808.1.74735 WP_000160808.1.7475 WP_000160808.1.74752 WP_000160808.1.74844 WP_000160808.1.74852 WP_000160808.1.74854 WP_000160808.1.74860 WP_000160808.1.74885 WP_000160808.1.74889 WP_000160808.1.74895 WP_000160808.1.74962 WP_000160808.1.74998 WP_000160808.1.75021 WP_000160808.1.75029 WP_000160808.1.75050 WP_000160808.1.75112 WP_000160808.1.75136 WP_000160808.1.75139 WP_000160808.1.75145 WP_000160808.1.75149 WP_000160808.1.75181 WP_000160808.1.75243 WP_000160808.1.75254 WP_000160808.1.75270 WP_000160808.1.75272 WP_000160808.1.75360 WP_000160808.1.75435 WP_000160808.1.75465 WP_000160808.1.75491 WP_000160808.1.75515 WP_000160808.1.75529 WP_000160808.1.75537 WP_000160808.1.75588 WP_000160808.1.75594 WP_000160808.1.75629 WP_000160808.1.75644 WP_000160808.1.75653 WP_000160808.1.75676 WP_000160808.1.75679 WP_000160808.1.75687 WP_000160808.1.75699 WP_000160808.1.75758 WP_000160808.1.75853 WP_000160808.1.75973 WP_000160808.1.75983 WP_000160808.1.75995 WP_000160808.1.75999 WP_000160808.1.76009 WP_000160808.1.7603 WP_000160808.1.76036 WP_000160808.1.76087 WP_000160808.1.76103 WP_000160808.1.76129 WP_000160808.1.76196 WP_000160808.1.76312 WP_000160808.1.76361 WP_000160808.1.76376 WP_000160808.1.76384 WP_000160808.1.76387 WP_000160808.1.76446 WP_000160808.1.76462 WP_000160808.1.76542 WP_000160808.1.76562 WP_000160808.1.7661 WP_000160808.1.76619 WP_000160808.1.76656 WP_000160808.1.76701 WP_000160808.1.76815 WP_000160808.1.76840 WP_000160808.1.76909 WP_000160808.1.76918 WP_000160808.1.76948 WP_000160808.1.76965 WP_000160808.1.76966 WP_000160808.1.7699 WP_000160808.1.77022 WP_000160808.1.77070 WP_000160808.1.77109 WP_000160808.1.77147 WP_000160808.1.77162 WP_000160808.1.77163 WP_000160808.1.77214 WP_000160808.1.77255 WP_000160808.1.77258 WP_000160808.1.7728 WP_000160808.1.77284 WP_000160808.1.77291 WP_000160808.1.7731 WP_000160808.1.77341 WP_000160808.1.77358 WP_000160808.1.77437 WP_000160808.1.77452 WP_000160808.1.77462 WP_000160808.1.77470 WP_000160808.1.77471 WP_000160808.1.77477 WP_000160808.1.77503 WP_000160808.1.77551 WP_000160808.1.77595 WP_000160808.1.77608 WP_000160808.1.77626 WP_000160808.1.77636 WP_000160808.1.77648 WP_000160808.1.77767 WP_000160808.1.77768 WP_000160808.1.7781 WP_000160808.1.77826 WP_000160808.1.77833 WP_000160808.1.77876 WP_000160808.1.77929 WP_000160808.1.77949 WP_000160808.1.77999 WP_000160808.1.78000 WP_000160808.1.7808 WP_000160808.1.78089 WP_000160808.1.78099 WP_000160808.1.78102 WP_000160808.1.78196 WP_000160808.1.78337 WP_000160808.1.78413 WP_000160808.1.78445 WP_000160808.1.78462 WP_000160808.1.7847 WP_000160808.1.78527 WP_000160808.1.78583 WP_000160808.1.78610 WP_000160808.1.78612 WP_000160808.1.78615 WP_000160808.1.78645 WP_000160808.1.78683 WP_000160808.1.78698 WP_000160808.1.78718 WP_000160808.1.78750 WP_000160808.1.78775 WP_000160808.1.78791 WP_000160808.1.7883 WP_000160808.1.78843 WP_000160808.1.78854 WP_000160808.1.78919 WP_000160808.1.78953 WP_000160808.1.78966 WP_000160808.1.7898 WP_000160808.1.7901 WP_000160808.1.79065 WP_000160808.1.79067 WP_000160808.1.79075 WP_000160808.1.79086 WP_000160808.1.79306 WP_000160808.1.79312 WP_000160808.1.79343 WP_000160808.1.79346 WP_000160808.1.79356 WP_000160808.1.79369 WP_000160808.1.7937 WP_000160808.1.79389 WP_000160808.1.79478 WP_000160808.1.79505 WP_000160808.1.79519 WP_000160808.1.79525 WP_000160808.1.79540 WP_000160808.1.79558 WP_000160808.1.79591 WP_000160808.1.79606 WP_000160808.1.79685 WP_000160808.1.79713 WP_000160808.1.79764 WP_000160808.1.79800 WP_000160808.1.79816 WP_000160808.1.79824 WP_000160808.1.79840 WP_000160808.1.7985 WP_000160808.1.7987 WP_000160808.1.79871 WP_000160808.1.79877 WP_000160808.1.79905 WP_000160808.1.7993 WP_000160808.1.79930 WP_000160808.1.79931 WP_000160808.1.79984 WP_000160808.1.80043 WP_000160808.1.80060 WP_000160808.1.8007 WP_000160808.1.80071 WP_000160808.1.80112 WP_000160808.1.80136 WP_000160808.1.80141 WP_000160808.1.80176 WP_000160808.1.80179 WP_000160808.1.80183 WP_000160808.1.80255 WP_000160808.1.80310 WP_000160808.1.80320 WP_000160808.1.80426 WP_000160808.1.80428 WP_000160808.1.80440 WP_000160808.1.80444 WP_000160808.1.80484 WP_000160808.1.80517 WP_000160808.1.80524 WP_000160808.1.80626 WP_000160808.1.80662 WP_000160808.1.80666 WP_000160808.1.80709 WP_000160808.1.80737 WP_000160808.1.80753 WP_000160808.1.80754 WP_000160808.1.80756 WP_000160808.1.80768 WP_000160808.1.80789 WP_000160808.1.80804 WP_000160808.1.80805 WP_000160808.1.80884 WP_000160808.1.80894 WP_000160808.1.8090 WP_000160808.1.80945 WP_000160808.1.80946 WP_000160808.1.810 WP_000160808.1.81026 WP_000160808.1.81034 WP_000160808.1.81054 WP_000160808.1.811 WP_000160808.1.81104 WP_000160808.1.81182 WP_000160808.1.8121 WP_000160808.1.81283 WP_000160808.1.81286 WP_000160808.1.8129 WP_000160808.1.81313 WP_000160808.1.81316 WP_000160808.1.81376 WP_000160808.1.81391 WP_000160808.1.81438 WP_000160808.1.81475 WP_000160808.1.81484 WP_000160808.1.81517 WP_000160808.1.81576 WP_000160808.1.81577 WP_000160808.1.81580 WP_000160808.1.81596 WP_000160808.1.81618 WP_000160808.1.8172 WP_000160808.1.81723 WP_000160808.1.81806 WP_000160808.1.81832 WP_000160808.1.81939 WP_000160808.1.81972 WP_000160808.1.82 WP_000160808.1.82062 WP_000160808.1.82074 WP_000160808.1.82217 WP_000160808.1.82239 WP_000160808.1.82242 WP_000160808.1.82246 WP_000160808.1.82316 WP_000160808.1.82326 WP_000160808.1.8235 WP_000160808.1.82378 WP_000160808.1.82439 WP_000160808.1.82499 WP_000160808.1.82572 WP_000160808.1.82626 WP_000160808.1.82647 WP_000160808.1.82691 WP_000160808.1.82700 WP_000160808.1.82718 WP_000160808.1.82754 WP_000160808.1.8277 WP_000160808.1.82799 WP_000160808.1.82831 WP_000160808.1.82853 WP_000160808.1.82902 WP_000160808.1.83035 WP_000160808.1.8306 WP_000160808.1.8308 WP_000160808.1.83097 WP_000160808.1.83140 WP_000160808.1.83205 WP_000160808.1.83224 WP_000160808.1.8345 WP_000160808.1.83481 WP_000160808.1.83537 WP_000160808.1.83544 WP_000160808.1.83564 WP_000160808.1.83584 WP_000160808.1.83684 WP_000160808.1.83820 WP_000160808.1.83941 WP_000160808.1.83947 WP_000160808.1.84004 WP_000160808.1.84060 WP_000160808.1.8411 WP_000160808.1.84140 WP_000160808.1.84172 WP_000160808.1.84185 WP_000160808.1.84313 WP_000160808.1.84348 WP_000160808.1.84405 WP_000160808.1.84410 WP_000160808.1.8444 WP_000160808.1.84473 WP_000160808.1.84484 WP_000160808.1.84511 WP_000160808.1.84534 WP_000160808.1.84584 WP_000160808.1.84656 WP_000160808.1.84668 WP_000160808.1.84697 WP_000160808.1.8470 WP_000160808.1.84738 WP_000160808.1.84740 WP_000160808.1.84850 WP_000160808.1.84875 WP_000160808.1.84877 WP_000160808.1.84881 WP_000160808.1.84893 WP_000160808.1.84894 WP_000160808.1.84929 WP_000160808.1.84941 WP_000160808.1.84977 WP_000160808.1.84989 WP_000160808.1.84994 WP_000160808.1.85002 WP_000160808.1.85011 WP_000160808.1.85052 WP_000160808.1.85090 WP_000160808.1.85098 WP_000160808.1.85105 WP_000160808.1.85112 WP_000160808.1.85129 WP_000160808.1.85175 WP_000160808.1.85216 WP_000160808.1.85247 WP_000160808.1.85255 WP_000160808.1.85260 WP_000160808.1.85310 WP_000160808.1.85335 WP_000160808.1.85342 WP_000160808.1.85435 WP_000160808.1.85500 WP_000160808.1.85525 WP_000160808.1.8560 WP_000160808.1.85621 WP_000160808.1.85657 WP_000160808.1.85752 WP_000160808.1.85762 WP_000160808.1.8579 WP_000160808.1.85806 WP_000160808.1.85857 WP_000160808.1.8592 WP_000160808.1.85939 WP_000160808.1.85944 WP_000160808.1.85948 WP_000160808.1.86001 WP_000160808.1.86016 WP_000160808.1.86035 WP_000160808.1.8607 WP_000160808.1.86110 WP_000160808.1.86115 WP_000160808.1.86149 WP_000160808.1.86161 WP_000160808.1.86181 WP_000160808.1.8621 WP_000160808.1.86210 WP_000160808.1.86263 WP_000160808.1.86266 WP_000160808.1.86276 WP_000160808.1.86283 WP_000160808.1.86307 WP_000160808.1.86355 WP_000160808.1.86371 WP_000160808.1.86393 WP_000160808.1.86411 WP_000160808.1.86412 WP_000160808.1.86451 WP_000160808.1.86452 WP_000160808.1.86492 WP_000160808.1.8652 WP_000160808.1.86583 WP_000160808.1.86609 WP_000160808.1.86617 WP_000160808.1.86640 WP_000160808.1.86667 WP_000160808.1.86674 WP_000160808.1.86691 WP_000160808.1.86707 WP_000160808.1.86787 WP_000160808.1.86833 WP_000160808.1.86848 WP_000160808.1.8687 WP_000160808.1.86956 WP_000160808.1.86959 WP_000160808.1.86997 WP_000160808.1.87075 WP_000160808.1.87109 WP_000160808.1.87189 WP_000160808.1.87199 WP_000160808.1.87249 WP_000160808.1.87310 WP_000160808.1.87358 WP_000160808.1.87400 WP_000160808.1.87410 WP_000160808.1.87465 WP_000160808.1.87557 WP_000160808.1.87563 WP_000160808.1.87568 WP_000160808.1.87574 WP_000160808.1.87610 WP_000160808.1.87639 WP_000160808.1.87655 WP_000160808.1.87694 WP_000160808.1.87726 WP_000160808.1.87788 WP_000160808.1.87789 WP_000160808.1.87834 WP_000160808.1.87857 WP_000160808.1.87914 WP_000160808.1.87919 WP_000160808.1.87973 WP_000160808.1.87980 WP_000160808.1.87989 WP_000160808.1.88017 WP_000160808.1.88020 WP_000160808.1.88088 WP_000160808.1.88149 WP_000160808.1.88155 WP_000160808.1.88238 WP_000160808.1.88252 WP_000160808.1.88304 WP_000160808.1.88376 WP_000160808.1.88379 WP_000160808.1.88384 WP_000160808.1.88427 WP_000160808.1.88462 WP_000160808.1.88535 WP_000160808.1.88539 WP_000160808.1.88603 WP_000160808.1.88607 WP_000160808.1.88646 WP_000160808.1.88667 WP_000160808.1.88709 WP_000160808.1.88711 WP_000160808.1.88729 WP_000160808.1.88732 WP_000160808.1.88757 WP_000160808.1.88759 WP_000160808.1.8879 WP_000160808.1.88834 WP_000160808.1.88997 WP_000160808.1.89050 WP_000160808.1.8906 WP_000160808.1.89067 WP_000160808.1.89090 WP_000160808.1.89165 WP_000160808.1.89183 WP_000160808.1.89197 WP_000160808.1.89200 WP_000160808.1.89255 WP_000160808.1.89305 WP_000160808.1.8938 WP_000160808.1.894 WP_000160808.1.89416 WP_000160808.1.89432 WP_000160808.1.8945 WP_000160808.1.89468 WP_000160808.1.89471 WP_000160808.1.89474 WP_000160808.1.89479 WP_000160808.1.89492 WP_000160808.1.89601 WP_000160808.1.89646 WP_000160808.1.89674 WP_000160808.1.89679 WP_000160808.1.89710 WP_000160808.1.89768 WP_000160808.1.89788 WP_000160808.1.89818 WP_000160808.1.89839 WP_000160808.1.89859 WP_000160808.1.89899 WP_000160808.1.89915 WP_000160808.1.89918 WP_000160808.1.89920 WP_000160808.1.89923 WP_000160808.1.89977 WP_000160808.1.90017 WP_000160808.1.90078 WP_000160808.1.9010 WP_000160808.1.90146 WP_000160808.1.90156 WP_000160808.1.90168 WP_000160808.1.90205 WP_000160808.1.90256 WP_000160808.1.90266 WP_000160808.1.90270 WP_000160808.1.90332 WP_000160808.1.90358 WP_000160808.1.9036 WP_000160808.1.90405 WP_000160808.1.90435 WP_000160808.1.90467 WP_000160808.1.90511 WP_000160808.1.90520 WP_000160808.1.90536 WP_000160808.1.9059 WP_000160808.1.90591 WP_000160808.1.9061 WP_000160808.1.90626 WP_000160808.1.90706 WP_000160808.1.9081 WP_000160808.1.90813 WP_000160808.1.90822 WP_000160808.1.90828 WP_000160808.1.90834 WP_000160808.1.90864 WP_000160808.1.90873 WP_000160808.1.90890 WP_000160808.1.90924 WP_000160808.1.90951 WP_000160808.1.90979 WP_000160808.1.91018 WP_000160808.1.91094 WP_000160808.1.91121 WP_000160808.1.91170 WP_000160808.1.91266 WP_000160808.1.91268 WP_000160808.1.91277 WP_000160808.1.91290 WP_000160808.1.91341 WP_000160808.1.91397 WP_000160808.1.91445 WP_000160808.1.91462 WP_000160808.1.915 WP_000160808.1.91511 WP_000160808.1.91551 WP_000160808.1.91565 WP_000160808.1.9157 WP_000160808.1.91596 WP_000160808.1.9160 WP_000160808.1.91643 WP_000160808.1.91644 WP_000160808.1.91672 WP_000160808.1.91685 WP_000160808.1.9169 WP_000160808.1.9171 WP_000160808.1.91739 WP_000160808.1.91777 WP_000160808.1.91782 WP_000160808.1.91787 WP_000160808.1.91850 WP_000160808.1.91959 WP_000160808.1.91971 WP_000160808.1.91994 WP_000160808.1.92014 WP_000160808.1.92019 WP_000160808.1.92048 WP_000160808.1.92058 WP_000160808.1.921 WP_000160808.1.92102 WP_000160808.1.9215 WP_000160808.1.92161 WP_000160808.1.92163 WP_000160808.1.92180 WP_000160808.1.92215 WP_000160808.1.92224 WP_000160808.1.92311 WP_000160808.1.92361 WP_000160808.1.92434 WP_000160808.1.92532 WP_000160808.1.9255 WP_000160808.1.92568 WP_000160808.1.92577 WP_000160808.1.92614 WP_000160808.1.92615 WP_000160808.1.9264 WP_000160808.1.9266 WP_000160808.1.92668 WP_000160808.1.92693 WP_000160808.1.92708 WP_000160808.1.92719 WP_000160808.1.92742 WP_000160808.1.92780 WP_000160808.1.92781 WP_000160808.1.92792 WP_000160808.1.92845 WP_000160808.1.92865 WP_000160808.1.92943 WP_000160808.1.92953 WP_000160808.1.92989 WP_000160808.1.93005 WP_000160808.1.93016 WP_000160808.1.93033 WP_000160808.1.93048 WP_000160808.1.93054 WP_000160808.1.93072 WP_000160808.1.93133 WP_000160808.1.93175 WP_000160808.1.93276 WP_000160808.1.93312 WP_000160808.1.93338 WP_000160808.1.93379 WP_000160808.1.93388 WP_000160808.1.93463 WP_000160808.1.93509 WP_000160808.1.93531 WP_000160808.1.93629 WP_000160808.1.93634 WP_000160808.1.93637 WP_000160808.1.93652 WP_000160808.1.93665 WP_000160808.1.93673 WP_000160808.1.93733 WP_000160808.1.93743 WP_000160808.1.93745 WP_000160808.1.93800 WP_000160808.1.93873 WP_000160808.1.93877 WP_000160808.1.93911 WP_000160808.1.93918 WP_000160808.1.93951 WP_000160808.1.93971 WP_000160808.1.94008 WP_000160808.1.94011 WP_000160808.1.94025 WP_000160808.1.94057 WP_000160808.1.94156 WP_000160808.1.94176 WP_000160808.1.94232 WP_000160808.1.94271 WP_000160808.1.94298 WP_000160808.1.94317 WP_000160808.1.94353 WP_000160808.1.94388 WP_000160808.1.94404 WP_000160808.1.94445 WP_000160808.1.94468 WP_000160808.1.94475 WP_000160808.1.94507 WP_000160808.1.94542 WP_000160808.1.94548 WP_000160808.1.94578 WP_000160808.1.94580 WP_000160808.1.94695 WP_000160808.1.94738 WP_000160808.1.94764 WP_000160808.1.94787 WP_000160808.1.948 WP_000160808.1.94808 WP_000160808.1.94822 WP_000160808.1.94880 WP_000160808.1.94889 WP_000160808.1.9489 WP_000160808.1.94898 WP_000160808.1.94903 WP_000160808.1.9491 WP_000160808.1.94993 WP_000160808.1.95005 WP_000160808.1.95022 WP_000160808.1.95037 WP_000160808.1.9513 WP_000160808.1.95161 WP_000160808.1.95198 WP_000160808.1.95243 WP_000160808.1.95244 WP_000160808.1.95332 WP_000160808.1.95368 WP_000160808.1.95381 WP_000160808.1.95390 WP_000160808.1.95395 WP_000160808.1.95424 WP_000160808.1.95438 WP_000160808.1.95490 WP_000160808.1.95518 WP_000160808.1.95521 WP_000160808.1.95563 WP_000160808.1.9559 WP_000160808.1.95604 WP_000160808.1.95611 WP_000160808.1.95655 WP_000160808.1.95771 WP_000160808.1.95800 WP_000160808.1.95824 WP_000160808.1.95849 WP_000160808.1.95865 WP_000160808.1.95916 WP_000160808.1.95919 WP_000160808.1.95931 WP_000160808.1.95932 WP_000160808.1.96053 WP_000160808.1.96066 WP_000160808.1.96114 WP_000160808.1.96177 WP_000160808.1.96222 WP_000160808.1.96229 WP_000160808.1.96247 WP_000160808.1.96279 WP_000160808.1.96299 WP_000160808.1.9631 WP_000160808.1.96339 WP_000160808.1.96341 WP_000160808.1.96394 WP_000160808.1.96417 WP_000160808.1.96457 WP_000160808.1.96494 WP_000160808.1.96541 WP_000160808.1.96562 WP_000160808.1.9657 WP_000160808.1.96585 WP_000160808.1.9661 WP_000160808.1.96659 WP_000160808.1.96743 WP_000160808.1.96817 WP_000160808.1.9690 WP_000160808.1.9691 WP_000160808.1.96924 WP_000160808.1.96936 WP_000160808.1.96944 WP_000160808.1.96984 WP_000160808.1.97011 WP_000160808.1.97027 WP_000160808.1.97049 WP_000160808.1.97059 WP_000160808.1.97119 WP_000160808.1.97200 WP_000160808.1.97231 WP_000160808.1.97238 WP_000160808.1.97248 WP_000160808.1.97344 WP_000160808.1.97356 WP_000160808.1.97360 WP_000160808.1.97361 WP_000160808.1.97418 WP_000160808.1.97421 WP_000160808.1.97434 WP_000160808.1.97439 WP_000160808.1.9747 WP_000160808.1.97490 WP_000160808.1.97538 WP_000160808.1.97544 WP_000160808.1.97560 WP_000160808.1.97667 WP_000160808.1.97685 WP_000160808.1.97705 WP_000160808.1.97822 WP_000160808.1.97930 WP_000160808.1.97932 WP_000160808.1.97937 WP_000160808.1.97962 WP_000160808.1.97982 WP_000160808.1.98026 WP_000160808.1.9803 WP_000160808.1.98082 WP_000160808.1.98115 WP_000160808.1.98139 WP_000160808.1.9816 WP_000160808.1.9817 WP_000160808.1.98220 WP_000160808.1.98232 WP_000160808.1.98235 WP_000160808.1.98239 WP_000160808.1.98244 WP_000160808.1.98292 WP_000160808.1.98294 WP_000160808.1.98301 WP_000160808.1.98355 WP_000160808.1.98357 WP_000160808.1.98400 WP_000160808.1.98424 WP_000160808.1.9844 WP_000160808.1.98442 WP_000160808.1.98477 WP_000160808.1.98549 WP_000160808.1.98578 WP_000160808.1.9858 WP_000160808.1.98614 WP_000160808.1.98628 WP_000160808.1.9864 WP_000160808.1.98654 WP_000160808.1.98665 WP_000160808.1.98683 WP_000160808.1.98875 WP_000160808.1.98988 WP_000160808.1.99029 WP_000160808.1.99046 WP_000160808.1.99168 WP_000160808.1.99209 WP_000160808.1.99246 WP_000160808.1.99265 WP_000160808.1.99292 WP_000160808.1.99295 WP_000160808.1.99302 WP_000160808.1.99304 WP_000160808.1.99334 WP_000160808.1.99345 WP_000160808.1.99361 WP_000160808.1.99392 WP_000160808.1.9940 WP_000160808.1.99400 WP_000160808.1.99446 WP_000160808.1.99475 WP_000160808.1.99486 WP_000160808.1.99511 WP_000160808.1.99534 WP_000160808.1.99562 WP_000160808.1.99592 WP_000160808.1.99602 WP_000160808.1.99619 WP_000160808.1.99632 WP_000160808.1.99666 WP_000160808.1.99804 WP_000160808.1.99827 WP_000160808.1.99869 YP_006777016.1.12065 gi|386711380|ref|YP_006175101.1| gi|386616291|ref|YP_006135957.1| gi|387614171|ref|YP_006117287.1| gi|378711075|ref|YP_005275968.1| gi|544391940|ref|YP_008566637.1| gi|443619561|ref|YP_007383417.1| gi|251786748|ref|YP_003001052.1| gi|218556048|ref|YP_002388961.1| 331111.EcE24377A_3982 409438.ECSE_3765 413997.ECB_03349 469008.ECBD_0241 573235.ECO26_4587 585034.ECIAI1_3645 585055.EC55989_3938 585395.ECO103_4226 585396.ECO111_4308 gi|218697206|ref|YP_002404873.1| gi|260870223|ref|YP_003236625.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]