SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|218556696|ref|YP_002389610.1| from Escherichia coli IAI1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|218556696|ref|YP_002389610.1|
Domain Number 1 Region: 3-92,331-547
Classification Level Classification E-value
Superfamily PDB 1.48e-180
Family PDB 0.0000000000571
Further Details:      
 
Domain Number 2 Region: 191-376
Classification Level Classification E-value
Superfamily GroEL apical domain-like 5.01e-149
Family GroEL-like chaperone, apical domain 0.00000511
Further Details:      
 
Domain Number 3 Region: 7-134,406-521
Classification Level Classification E-value
Superfamily GroEL equatorial domain-like 5.98e-78
Family GroEL chaperone, ATPase domain 0.0000000665
Further Details:      
 
Domain Number 4 Region: 137-203
Classification Level Classification E-value
Superfamily GroEL-intermediate domain like 1.41e-24
Family GroEL-like chaperone, intermediate domain 0.0000665
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|218556696|ref|YP_002389610.1|
Sequence length 548
Comment chaperonin GroEL [Escherichia coli IAI1]
Sequence
MAAKDVKFGNDARVKMLRGVNVLADAVKVTLGPKGRNVVLDKSFGAPTITKDGVSVAREI
ELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQAIITEGLKAVAAGMNPMDLKRGI
DKAVTAAVEELKALSVPCSDSKAIAQVGTISANSDETVGKLIAEAMDKVGKEGVITVEDG
TGLQDELDVVEGMQFDRGYLSPYFINKPETGAVELESPFILLADKKISNIREMLPVLEAV
AKAGKPLLIIAEDVEGEALATLVVNTMRGIVKVAAVKAPGFGDRRKAMLQDIATLTGGTV
ISEEIGMELEKATLEDLGQAKRVVINKDTTTIIDGVGEEAAIQGRVAQIRQQIEEATSDY
DREKLQERVAKLAGGVAVIKVGAATEVEMKEKKARVEDALHATRAAVEEGVVAGGGVALI
RVASKLADLRGQNEDQNVGIKVALRAMEAPLRQIVLNCGEEPSVVANTVKGGDGNYGYNA
ATEEYGNMIDMGILDPTKVTRSALQYAASVAGLMITTECMVTDLPKNDAADLGAAGGMGG
MGGMGGMM
Download sequence
Identical sequences A0A023Z718 A0A024KM74 A0A025CNL0 A0A026USZ2 A0A027U4V4 A0A027ZDL3 A0A028DUQ8 A0A029HC60 A0A029IGB8 A0A062XRC2 A0A064SWN4 A0A069XPU4 A0A070FAZ5 A0A070UJF9 A0A073FM47 A0A073GYI3 A0A073UUV2 A0A074IRL3 A0A077ZAW5 A0A080I8P4 A0A0A0FAI7 A0A0A8UIA0 A0A0E0U6Y0 A0A0E0VDR9 A0A0E0Y6J4 A0A0E1M4T8 A0A0E1SZX2 A0A0E2KWX8 A0A0E2TPA2 A0A0F6CCA3 A0A0F6FFV3 A0A0F6MKB7 A0A0G3KHC8 A0A0H3ESC4 A0A0H3PV97 A0A0H8CGX8 A0A0K9TI33 A0A0M7MV12 A0A125WV61 A0A127GSW1 A0A140NH65 A0A142GY45 A0A181WPU4 A0A192CFJ5 A0A1E2VLU0 A0A1Q8MBN1 A0A1Q8NTH2 A0A1S6TJC1 A0A1W2MIQ7 A0A1X3HZ46 A0A1X3IH48 A0A1X3J6T7 A0A1X3J8I0 A0A1X3KMU4 A0A1X3KUQ8 A0A1X3L7V3 A0A1X3M2S2 A0A1Z3UVY7 A0A222QTN2 A0A226K6C2 A0A2D0NY82 A0A2H1BQL9 A1AJ51 A7ZV12 A8A7N9 B1ITQ5 B1LQG4 B1XDP7 B2TY18 B3X5R8 B3Y1P5 B5Z2F2 B6I615 B7LC02 B7M8Q4 B7MKU8 B7MSV9 B7NG81 B7NTK2 B7UPW3 C5A1D5 C8U0A7 D2AEB3 D3GV45 D3QL64 D6I440 D6IH84 D6J5C1 D7XAS5 D7XSB4 D7YA27 D7ZGR4 D8AFJ6 D8E3M8 E0J056 E1IV47 E1J2N4 E2XEC5 E3PDA1 E3XLX2 E6BJH9 E7SG91 E7SXG8 E7T6Y2 E9TAC0 E9YWT8 F3VEN6 F3WRH9 F4NKE4 F4SSL0 F4T7U4 F4TP48 F4UXX9 F4VMD7 F5MWC2 F5P0M7 G0F4V0 H4IJY1 H4J0T7 H4J2E2 H4KQX4 H4LL40 H4USJ8 I0VYF7 I2RCB2 I2RS14 I2SQE4 I2URS8 I2W9P1 I2WT36 I2XFL9 I4T6E3 I6C8J9 I6CT16 I6DCB7 I6FF01 J7RZI3 K0WNQ6 K4WCQ6 K4XJH1 L2VBP4 L2X178 L3BVZ1 L3PEP0 L3PRB4 L3Q4V1 L4JKK2 L4UWM7 P0A6F5 P0A6F6 P0A6F7 P0A6F8 Q0SXD6 Q1R3B6 Q31T78 Q328C4 Q3YUJ7 Q548M1 S0UWN2 S0XIH9 S0YPM9 S1D153 S1E571 S1H987 S1IBH0 S1JE98 S1NP74 T5U2J6 T5Z581 T6GGU3 T6KYC6 T9ANU6 T9BZX7 T9T1D2 U9Y0N1 U9Y8H7 U9YQN1 V0A0D9 V0A443 V0T3X6 V0W8Y6 V0Y751 V0YTA4 V2Q402 V2S987 V6G2Y1 V8F384 V8KEY1 W1B1W5 W8ZRI5
gi|170083592|ref|YP_001732912.1| gi|15834378|ref|NP_313151.1| gi|471335614|ref|YP_007559091.1| gi|254164075|ref|YP_003047183.1| gi|378714908|ref|YP_005279801.1| gi|386712088|ref|YP_006175809.1| gi|378714908|ref|YP_005279801.1| gi|386617053|ref|YP_006136719.1| gi|209398215|ref|YP_002273688.1| gi|170021846|ref|YP_001726800.1| gi|82546611|ref|YP_410558.1| gi|386632152|ref|YP_006151872.1| gi|251787396|ref|YP_003001700.1| gi|209921633|ref|YP_002295717.1| gi|253775229|ref|YP_003038060.1| gi|556553966|ref|YP_008724544.1| gi|386712088|ref|YP_006175809.1| gi|254796165|ref|YP_003081002.1| gi|215489490|ref|YP_002331921.1| gi|218697893|ref|YP_002405560.1| gi|260858296|ref|YP_003232187.1| gi|251787396|ref|YP_003001700.1| gi|291285559|ref|YP_003502377.1| gi|410484634|ref|YP_006772180.1| 4pkn_A 4pkn_B 4pkn_C 4pkn_D 4pkn_E 4pkn_F 4pkn_G 4pkn_H 4pkn_I 4pkn_J 4pkn_K 4pkn_L 4pkn_M 4pkn_N 4pko_A 4pko_B 4pko_C 4pko_D 4pko_E 4pko_F 4pko_G 4pko_H 4pko_I 4pko_J 4pko_K 4pko_L 4pko_M 4pko_N gi|117626492|ref|YP_859815.1| gi|91213693|ref|YP_543679.1| gi|387619534|ref|YP_006122556.1| gi|157163608|ref|YP_001460926.1| gi|187734256|ref|YP_001882834.1| gi|218707758|ref|YP_002415277.1| gi|386707377|ref|YP_006171224.1| gi|157159099|ref|YP_001465641.1| gi|110808064|ref|YP_691584.1| gi|218556696|ref|YP_002389610.1| gi|386606731|ref|YP_006113031.1| gi|30065518|ref|NP_839689.1| NP_313151.1.58667 NP_418567.1.90541 NP_710008.1.23235 WP_000729117.1.10001 WP_000729117.1.100014 WP_000729117.1.100044 WP_000729117.1.100052 WP_000729117.1.100063 WP_000729117.1.100066 WP_000729117.1.100073 WP_000729117.1.100085 WP_000729117.1.10010 WP_000729117.1.100116 WP_000729117.1.100135 WP_000729117.1.100138 WP_000729117.1.100151 WP_000729117.1.100159 WP_000729117.1.100185 WP_000729117.1.100194 WP_000729117.1.100220 WP_000729117.1.100227 WP_000729117.1.100251 WP_000729117.1.100252 WP_000729117.1.100281 WP_000729117.1.100285 WP_000729117.1.100299 WP_000729117.1.100302 WP_000729117.1.100304 WP_000729117.1.100306 WP_000729117.1.100315 WP_000729117.1.10034 WP_000729117.1.100346 WP_000729117.1.100389 WP_000729117.1.100425 WP_000729117.1.100441 WP_000729117.1.100444 WP_000729117.1.100447 WP_000729117.1.100448 WP_000729117.1.100451 WP_000729117.1.100474 WP_000729117.1.10048 WP_000729117.1.100487 WP_000729117.1.100496 WP_000729117.1.100499 WP_000729117.1.100508 WP_000729117.1.10051 WP_000729117.1.100543 WP_000729117.1.100554 WP_000729117.1.100571 WP_000729117.1.100573 WP_000729117.1.100614 WP_000729117.1.100667 WP_000729117.1.10067 WP_000729117.1.10068 WP_000729117.1.100685 WP_000729117.1.100688 WP_000729117.1.100689 WP_000729117.1.100718 WP_000729117.1.100725 WP_000729117.1.100735 WP_000729117.1.100738 WP_000729117.1.100752 WP_000729117.1.100753 WP_000729117.1.100758 WP_000729117.1.100778 WP_000729117.1.100796 WP_000729117.1.10080 WP_000729117.1.100803 WP_000729117.1.100824 WP_000729117.1.100836 WP_000729117.1.100851 WP_000729117.1.100852 WP_000729117.1.10086 WP_000729117.1.100867 WP_000729117.1.100868 WP_000729117.1.100898 WP_000729117.1.100916 WP_000729117.1.100928 WP_000729117.1.100933 WP_000729117.1.100950 WP_000729117.1.100959 WP_000729117.1.100966 WP_000729117.1.100990 WP_000729117.1.10100 WP_000729117.1.101052 WP_000729117.1.101087 WP_000729117.1.101096 WP_000729117.1.1011 WP_000729117.1.101102 WP_000729117.1.101105 WP_000729117.1.101110 WP_000729117.1.101121 WP_000729117.1.101148 WP_000729117.1.101152 WP_000729117.1.101157 WP_000729117.1.101158 WP_000729117.1.101166 WP_000729117.1.101175 WP_000729117.1.101186 WP_000729117.1.101206 WP_000729117.1.101214 WP_000729117.1.101216 WP_000729117.1.101257 WP_000729117.1.10126 WP_000729117.1.101282 WP_000729117.1.101289 WP_000729117.1.10131 WP_000729117.1.101313 WP_000729117.1.101359 WP_000729117.1.10138 WP_000729117.1.101387 WP_000729117.1.101399 WP_000729117.1.101423 WP_000729117.1.101429 WP_000729117.1.101430 WP_000729117.1.101436 WP_000729117.1.101439 WP_000729117.1.101445 WP_000729117.1.101468 WP_000729117.1.101486 WP_000729117.1.101522 WP_000729117.1.10154 WP_000729117.1.101545 WP_000729117.1.101586 WP_000729117.1.101594 WP_000729117.1.101628 WP_000729117.1.101651 WP_000729117.1.101653 WP_000729117.1.101654 WP_000729117.1.101667 WP_000729117.1.101668 WP_000729117.1.101686 WP_000729117.1.101693 WP_000729117.1.101694 WP_000729117.1.101727 WP_000729117.1.10173 WP_000729117.1.101737 WP_000729117.1.101747 WP_000729117.1.101769 WP_000729117.1.101786 WP_000729117.1.10181 WP_000729117.1.10184 WP_000729117.1.101840 WP_000729117.1.101845 WP_000729117.1.101855 WP_000729117.1.101865 WP_000729117.1.10187 WP_000729117.1.10188 WP_000729117.1.101887 WP_000729117.1.101889 WP_000729117.1.10190 WP_000729117.1.101900 WP_000729117.1.101908 WP_000729117.1.101913 WP_000729117.1.101926 WP_000729117.1.101932 WP_000729117.1.101937 WP_000729117.1.101940 WP_000729117.1.101942 WP_000729117.1.101947 WP_000729117.1.101948 WP_000729117.1.101952 WP_000729117.1.101962 WP_000729117.1.101964 WP_000729117.1.101969 WP_000729117.1.101977 WP_000729117.1.101984 WP_000729117.1.102021 WP_000729117.1.10206 WP_000729117.1.102069 WP_000729117.1.102076 WP_000729117.1.102093 WP_000729117.1.102094 WP_000729117.1.102104 WP_000729117.1.102106 WP_000729117.1.102122 WP_000729117.1.102139 WP_000729117.1.10222 WP_000729117.1.10226 WP_000729117.1.10235 WP_000729117.1.10252 WP_000729117.1.10273 WP_000729117.1.10304 WP_000729117.1.10326 WP_000729117.1.10329 WP_000729117.1.10335 WP_000729117.1.10348 WP_000729117.1.10352 WP_000729117.1.10361 WP_000729117.1.10379 WP_000729117.1.10381 WP_000729117.1.1040 WP_000729117.1.10400 WP_000729117.1.10417 WP_000729117.1.10461 WP_000729117.1.10491 WP_000729117.1.10492 WP_000729117.1.10496 WP_000729117.1.10508 WP_000729117.1.10524 WP_000729117.1.10525 WP_000729117.1.10538 WP_000729117.1.10569 WP_000729117.1.10573 WP_000729117.1.10576 WP_000729117.1.10579 WP_000729117.1.1058 WP_000729117.1.10605 WP_000729117.1.10628 WP_000729117.1.10651 WP_000729117.1.10673 WP_000729117.1.10697 WP_000729117.1.10705 WP_000729117.1.1071 WP_000729117.1.10715 WP_000729117.1.1073 WP_000729117.1.1074 WP_000729117.1.10744 WP_000729117.1.10748 WP_000729117.1.10761 WP_000729117.1.10763 WP_000729117.1.10771 WP_000729117.1.10786 WP_000729117.1.10787 WP_000729117.1.10798 WP_000729117.1.10809 WP_000729117.1.10814 WP_000729117.1.10824 WP_000729117.1.10833 WP_000729117.1.10842 WP_000729117.1.10849 WP_000729117.1.10862 WP_000729117.1.10869 WP_000729117.1.10922 WP_000729117.1.10970 WP_000729117.1.10988 WP_000729117.1.10989 WP_000729117.1.10994 WP_000729117.1.10995 WP_000729117.1.11006 WP_000729117.1.11032 WP_000729117.1.11047 WP_000729117.1.11052 WP_000729117.1.11057 WP_000729117.1.11068 WP_000729117.1.11071 WP_000729117.1.11091 WP_000729117.1.1111 WP_000729117.1.11113 WP_000729117.1.11118 WP_000729117.1.11121 WP_000729117.1.1113 WP_000729117.1.11133 WP_000729117.1.112 WP_000729117.1.11217 WP_000729117.1.1122 WP_000729117.1.11240 WP_000729117.1.11241 WP_000729117.1.11250 WP_000729117.1.11251 WP_000729117.1.11265 WP_000729117.1.11272 WP_000729117.1.11285 WP_000729117.1.11296 WP_000729117.1.11301 WP_000729117.1.11315 WP_000729117.1.11323 WP_000729117.1.11399 WP_000729117.1.11408 WP_000729117.1.11411 WP_000729117.1.11420 WP_000729117.1.11436 WP_000729117.1.11437 WP_000729117.1.11440 WP_000729117.1.11467 WP_000729117.1.11499 WP_000729117.1.11519 WP_000729117.1.11524 WP_000729117.1.11531 WP_000729117.1.11542 WP_000729117.1.11575 WP_000729117.1.11595 WP_000729117.1.11607 WP_000729117.1.11612 WP_000729117.1.11616 WP_000729117.1.11645 WP_000729117.1.11671 WP_000729117.1.11673 WP_000729117.1.1168 WP_000729117.1.11690 WP_000729117.1.11699 WP_000729117.1.11748 WP_000729117.1.11759 WP_000729117.1.1176 WP_000729117.1.11762 WP_000729117.1.11801 WP_000729117.1.11803 WP_000729117.1.1186 WP_000729117.1.11912 WP_000729117.1.11949 WP_000729117.1.11955 WP_000729117.1.11956 WP_000729117.1.1196 WP_000729117.1.11981 WP_000729117.1.11982 WP_000729117.1.11985 WP_000729117.1.12000 WP_000729117.1.12009 WP_000729117.1.12010 WP_000729117.1.12030 WP_000729117.1.12036 WP_000729117.1.12050 WP_000729117.1.12051 WP_000729117.1.12060 WP_000729117.1.12076 WP_000729117.1.12088 WP_000729117.1.12095 WP_000729117.1.12111 WP_000729117.1.12112 WP_000729117.1.12115 WP_000729117.1.1212 WP_000729117.1.12151 WP_000729117.1.12157 WP_000729117.1.1218 WP_000729117.1.12204 WP_000729117.1.12230 WP_000729117.1.12268 WP_000729117.1.12279 WP_000729117.1.12292 WP_000729117.1.12295 WP_000729117.1.12305 WP_000729117.1.12319 WP_000729117.1.12320 WP_000729117.1.12342 WP_000729117.1.12344 WP_000729117.1.12352 WP_000729117.1.12415 WP_000729117.1.1242 WP_000729117.1.12426 WP_000729117.1.12458 WP_000729117.1.12459 WP_000729117.1.12468 WP_000729117.1.12478 WP_000729117.1.12542 WP_000729117.1.12552 WP_000729117.1.12558 WP_000729117.1.12566 WP_000729117.1.12574 WP_000729117.1.12582 WP_000729117.1.12594 WP_000729117.1.12623 WP_000729117.1.12645 WP_000729117.1.12646 WP_000729117.1.12675 WP_000729117.1.12679 WP_000729117.1.12693 WP_000729117.1.12697 WP_000729117.1.127 WP_000729117.1.12717 WP_000729117.1.12743 WP_000729117.1.12749 WP_000729117.1.1275 WP_000729117.1.12761 WP_000729117.1.12762 WP_000729117.1.12766 WP_000729117.1.12775 WP_000729117.1.1278 WP_000729117.1.12781 WP_000729117.1.1280 WP_000729117.1.12826 WP_000729117.1.12830 WP_000729117.1.12831 WP_000729117.1.12876 WP_000729117.1.12893 WP_000729117.1.12911 WP_000729117.1.12914 WP_000729117.1.12917 WP_000729117.1.12944 WP_000729117.1.1295 WP_000729117.1.12956 WP_000729117.1.12965 WP_000729117.1.12976 WP_000729117.1.12979 WP_000729117.1.12987 WP_000729117.1.12991 WP_000729117.1.13002 WP_000729117.1.13015 WP_000729117.1.13031 WP_000729117.1.13060 WP_000729117.1.13074 WP_000729117.1.1308 WP_000729117.1.13117 WP_000729117.1.1312 WP_000729117.1.13136 WP_000729117.1.1314 WP_000729117.1.13144 WP_000729117.1.13157 WP_000729117.1.13162 WP_000729117.1.13176 WP_000729117.1.13181 WP_000729117.1.13205 WP_000729117.1.13217 WP_000729117.1.13222 WP_000729117.1.13223 WP_000729117.1.1323 WP_000729117.1.13239 WP_000729117.1.13252 WP_000729117.1.13271 WP_000729117.1.13278 WP_000729117.1.13281 WP_000729117.1.13295 WP_000729117.1.13301 WP_000729117.1.13332 WP_000729117.1.13333 WP_000729117.1.13346 WP_000729117.1.13348 WP_000729117.1.1335 WP_000729117.1.13383 WP_000729117.1.13393 WP_000729117.1.13409 WP_000729117.1.13411 WP_000729117.1.1343 WP_000729117.1.13430 WP_000729117.1.13437 WP_000729117.1.13442 WP_000729117.1.1345 WP_000729117.1.13451 WP_000729117.1.13469 WP_000729117.1.13473 WP_000729117.1.13525 WP_000729117.1.13566 WP_000729117.1.13585 WP_000729117.1.13589 WP_000729117.1.13601 WP_000729117.1.13608 WP_000729117.1.13624 WP_000729117.1.13626 WP_000729117.1.13644 WP_000729117.1.13656 WP_000729117.1.13662 WP_000729117.1.13672 WP_000729117.1.13740 WP_000729117.1.13778 WP_000729117.1.13791 WP_000729117.1.13798 WP_000729117.1.13824 WP_000729117.1.13867 WP_000729117.1.13877 WP_000729117.1.13881 WP_000729117.1.13891 WP_000729117.1.13924 WP_000729117.1.13934 WP_000729117.1.13936 WP_000729117.1.13939 WP_000729117.1.13944 WP_000729117.1.13949 WP_000729117.1.13974 WP_000729117.1.13981 WP_000729117.1.14023 WP_000729117.1.14030 WP_000729117.1.14042 WP_000729117.1.14058 WP_000729117.1.14062 WP_000729117.1.14070 WP_000729117.1.14094 WP_000729117.1.14110 WP_000729117.1.14127 WP_000729117.1.14129 WP_000729117.1.14154 WP_000729117.1.1419 WP_000729117.1.14199 WP_000729117.1.142 WP_000729117.1.14245 WP_000729117.1.14253 WP_000729117.1.14277 WP_000729117.1.14292 WP_000729117.1.14299 WP_000729117.1.14304 WP_000729117.1.14322 WP_000729117.1.14331 WP_000729117.1.14346 WP_000729117.1.14371 WP_000729117.1.1438 WP_000729117.1.14389 WP_000729117.1.1439 WP_000729117.1.14398 WP_000729117.1.14417 WP_000729117.1.14432 WP_000729117.1.14445 WP_000729117.1.14451 WP_000729117.1.14453 WP_000729117.1.14468 WP_000729117.1.14493 WP_000729117.1.14499 WP_000729117.1.14501 WP_000729117.1.14506 WP_000729117.1.14508 WP_000729117.1.14509 WP_000729117.1.14529 WP_000729117.1.14538 WP_000729117.1.14581 WP_000729117.1.14582 WP_000729117.1.14600 WP_000729117.1.14601 WP_000729117.1.14605 WP_000729117.1.14607 WP_000729117.1.1461 WP_000729117.1.14616 WP_000729117.1.14621 WP_000729117.1.14648 WP_000729117.1.14661 WP_000729117.1.14672 WP_000729117.1.14678 WP_000729117.1.14687 WP_000729117.1.14693 WP_000729117.1.1470 WP_000729117.1.14711 WP_000729117.1.14712 WP_000729117.1.14746 WP_000729117.1.14748 WP_000729117.1.14749 WP_000729117.1.14807 WP_000729117.1.14811 WP_000729117.1.14833 WP_000729117.1.1486 WP_000729117.1.14861 WP_000729117.1.14871 WP_000729117.1.14879 WP_000729117.1.14934 WP_000729117.1.14935 WP_000729117.1.14946 WP_000729117.1.14956 WP_000729117.1.14958 WP_000729117.1.14963 WP_000729117.1.14965 WP_000729117.1.14977 WP_000729117.1.14992 WP_000729117.1.14993 WP_000729117.1.15007 WP_000729117.1.15020 WP_000729117.1.15041 WP_000729117.1.1508 WP_000729117.1.15087 WP_000729117.1.15090 WP_000729117.1.1510 WP_000729117.1.15117 WP_000729117.1.1512 WP_000729117.1.15121 WP_000729117.1.15138 WP_000729117.1.15148 WP_000729117.1.15177 WP_000729117.1.15191 WP_000729117.1.15193 WP_000729117.1.15207 WP_000729117.1.15221 WP_000729117.1.1524 WP_000729117.1.15245 WP_000729117.1.15252 WP_000729117.1.15259 WP_000729117.1.15270 WP_000729117.1.15277 WP_000729117.1.15282 WP_000729117.1.15287 WP_000729117.1.15290 WP_000729117.1.153 WP_000729117.1.15300 WP_000729117.1.15304 WP_000729117.1.15332 WP_000729117.1.15335 WP_000729117.1.15347 WP_000729117.1.15356 WP_000729117.1.15377 WP_000729117.1.15416 WP_000729117.1.15420 WP_000729117.1.1543 WP_000729117.1.15444 WP_000729117.1.15453 WP_000729117.1.15464 WP_000729117.1.15469 WP_000729117.1.15496 WP_000729117.1.1550 WP_000729117.1.15503 WP_000729117.1.15521 WP_000729117.1.15527 WP_000729117.1.15528 WP_000729117.1.15538 WP_000729117.1.15565 WP_000729117.1.15576 WP_000729117.1.15583 WP_000729117.1.1559 WP_000729117.1.15593 WP_000729117.1.15600 WP_000729117.1.1561 WP_000729117.1.15620 WP_000729117.1.15624 WP_000729117.1.15626 WP_000729117.1.15645 WP_000729117.1.15654 WP_000729117.1.15702 WP_000729117.1.15707 WP_000729117.1.15740 WP_000729117.1.15747 WP_000729117.1.15752 WP_000729117.1.15762 WP_000729117.1.15767 WP_000729117.1.15768 WP_000729117.1.15771 WP_000729117.1.15782 WP_000729117.1.15791 WP_000729117.1.1580 WP_000729117.1.15809 WP_000729117.1.1582 WP_000729117.1.15855 WP_000729117.1.15857 WP_000729117.1.15863 WP_000729117.1.15869 WP_000729117.1.1588 WP_000729117.1.15894 WP_000729117.1.15906 WP_000729117.1.15916 WP_000729117.1.15945 WP_000729117.1.15949 WP_000729117.1.15951 WP_000729117.1.15983 WP_000729117.1.15984 WP_000729117.1.15990 WP_000729117.1.16010 WP_000729117.1.16014 WP_000729117.1.16015 WP_000729117.1.16034 WP_000729117.1.1604 WP_000729117.1.16042 WP_000729117.1.16067 WP_000729117.1.16075 WP_000729117.1.16086 WP_000729117.1.16087 WP_000729117.1.1609 WP_000729117.1.16102 WP_000729117.1.16111 WP_000729117.1.16117 WP_000729117.1.16131 WP_000729117.1.16133 WP_000729117.1.16154 WP_000729117.1.16171 WP_000729117.1.16175 WP_000729117.1.16179 WP_000729117.1.16188 WP_000729117.1.16194 WP_000729117.1.1621 WP_000729117.1.16222 WP_000729117.1.16270 WP_000729117.1.16272 WP_000729117.1.16294 WP_000729117.1.163 WP_000729117.1.16303 WP_000729117.1.16322 WP_000729117.1.1634 WP_000729117.1.16387 WP_000729117.1.16388 WP_000729117.1.16396 WP_000729117.1.1640 WP_000729117.1.16435 WP_000729117.1.16463 WP_000729117.1.16481 WP_000729117.1.16482 WP_000729117.1.16500 WP_000729117.1.16517 WP_000729117.1.16532 WP_000729117.1.16539 WP_000729117.1.16541 WP_000729117.1.1655 WP_000729117.1.16592 WP_000729117.1.16604 WP_000729117.1.16608 WP_000729117.1.16612 WP_000729117.1.16640 WP_000729117.1.16648 WP_000729117.1.16667 WP_000729117.1.16669 WP_000729117.1.16682 WP_000729117.1.16685 WP_000729117.1.16705 WP_000729117.1.16715 WP_000729117.1.16721 WP_000729117.1.1673 WP_000729117.1.16745 WP_000729117.1.16752 WP_000729117.1.16766 WP_000729117.1.16780 WP_000729117.1.16798 WP_000729117.1.16799 WP_000729117.1.16805 WP_000729117.1.16807 WP_000729117.1.16818 WP_000729117.1.16843 WP_000729117.1.16845 WP_000729117.1.16861 WP_000729117.1.16862 WP_000729117.1.16894 WP_000729117.1.16927 WP_000729117.1.16970 WP_000729117.1.16979 WP_000729117.1.16992 WP_000729117.1.17014 WP_000729117.1.17018 WP_000729117.1.17028 WP_000729117.1.17042 WP_000729117.1.17061 WP_000729117.1.17084 WP_000729117.1.17085 WP_000729117.1.17087 WP_000729117.1.17089 WP_000729117.1.1710 WP_000729117.1.17101 WP_000729117.1.17102 WP_000729117.1.17111 WP_000729117.1.17114 WP_000729117.1.17119 WP_000729117.1.17123 WP_000729117.1.17153 WP_000729117.1.17170 WP_000729117.1.17172 WP_000729117.1.17182 WP_000729117.1.17186 WP_000729117.1.17187 WP_000729117.1.17205 WP_000729117.1.17206 WP_000729117.1.17216 WP_000729117.1.17230 WP_000729117.1.17241 WP_000729117.1.17242 WP_000729117.1.1726 WP_000729117.1.17267 WP_000729117.1.17282 WP_000729117.1.17290 WP_000729117.1.17297 WP_000729117.1.17300 WP_000729117.1.17301 WP_000729117.1.1731 WP_000729117.1.17333 WP_000729117.1.17356 WP_000729117.1.17360 WP_000729117.1.17373 WP_000729117.1.17386 WP_000729117.1.17387 WP_000729117.1.17389 WP_000729117.1.17392 WP_000729117.1.17403 WP_000729117.1.17410 WP_000729117.1.17415 WP_000729117.1.17417 WP_000729117.1.17432 WP_000729117.1.17441 WP_000729117.1.17464 WP_000729117.1.17496 WP_000729117.1.17515 WP_000729117.1.17534 WP_000729117.1.1754 WP_000729117.1.1755 WP_000729117.1.17568 WP_000729117.1.17570 WP_000729117.1.17577 WP_000729117.1.17584 WP_000729117.1.17595 WP_000729117.1.17623 WP_000729117.1.1763 WP_000729117.1.17637 WP_000729117.1.1766 WP_000729117.1.17680 WP_000729117.1.1769 WP_000729117.1.17711 WP_000729117.1.1772 WP_000729117.1.17734 WP_000729117.1.17757 WP_000729117.1.17765 WP_000729117.1.17769 WP_000729117.1.17802 WP_000729117.1.17829 WP_000729117.1.17831 WP_000729117.1.17836 WP_000729117.1.17849 WP_000729117.1.17889 WP_000729117.1.17904 WP_000729117.1.17920 WP_000729117.1.17925 WP_000729117.1.17937 WP_000729117.1.17952 WP_000729117.1.17961 WP_000729117.1.17963 WP_000729117.1.17984 WP_000729117.1.18000 WP_000729117.1.18006 WP_000729117.1.1802 WP_000729117.1.18024 WP_000729117.1.18050 WP_000729117.1.18064 WP_000729117.1.18094 WP_000729117.1.18112 WP_000729117.1.18118 WP_000729117.1.18121 WP_000729117.1.18133 WP_000729117.1.18134 WP_000729117.1.18136 WP_000729117.1.18175 WP_000729117.1.1821 WP_000729117.1.18225 WP_000729117.1.18229 WP_000729117.1.18275 WP_000729117.1.18311 WP_000729117.1.18316 WP_000729117.1.18326 WP_000729117.1.18329 WP_000729117.1.18337 WP_000729117.1.18338 WP_000729117.1.1834 WP_000729117.1.18340 WP_000729117.1.18348 WP_000729117.1.18354 WP_000729117.1.18381 WP_000729117.1.18383 WP_000729117.1.18394 WP_000729117.1.18402 WP_000729117.1.18410 WP_000729117.1.18420 WP_000729117.1.18436 WP_000729117.1.18438 WP_000729117.1.1844 WP_000729117.1.18458 WP_000729117.1.18461 WP_000729117.1.18472 WP_000729117.1.18482 WP_000729117.1.18511 WP_000729117.1.18519 WP_000729117.1.18530 WP_000729117.1.18550 WP_000729117.1.18556 WP_000729117.1.18581 WP_000729117.1.18583 WP_000729117.1.18588 WP_000729117.1.1861 WP_000729117.1.18617 WP_000729117.1.1862 WP_000729117.1.18628 WP_000729117.1.18649 WP_000729117.1.18650 WP_000729117.1.18651 WP_000729117.1.18655 WP_000729117.1.1866 WP_000729117.1.18666 WP_000729117.1.1867 WP_000729117.1.18675 WP_000729117.1.18699 WP_000729117.1.18714 WP_000729117.1.18725 WP_000729117.1.18726 WP_000729117.1.1873 WP_000729117.1.18734 WP_000729117.1.18794 WP_000729117.1.188 WP_000729117.1.18801 WP_000729117.1.18806 WP_000729117.1.1881 WP_000729117.1.18837 WP_000729117.1.18843 WP_000729117.1.18858 WP_000729117.1.18861 WP_000729117.1.18874 WP_000729117.1.18876 WP_000729117.1.18899 WP_000729117.1.18908 WP_000729117.1.18923 WP_000729117.1.18929 WP_000729117.1.18936 WP_000729117.1.1896 WP_000729117.1.18966 WP_000729117.1.18983 WP_000729117.1.18995 WP_000729117.1.19024 WP_000729117.1.1903 WP_000729117.1.19036 WP_000729117.1.19039 WP_000729117.1.1906 WP_000729117.1.19075 WP_000729117.1.1909 WP_000729117.1.19090 WP_000729117.1.191 WP_000729117.1.19100 WP_000729117.1.19113 WP_000729117.1.19114 WP_000729117.1.19122 WP_000729117.1.19129 WP_000729117.1.19140 WP_000729117.1.19146 WP_000729117.1.19147 WP_000729117.1.19148 WP_000729117.1.1915 WP_000729117.1.19150 WP_000729117.1.19153 WP_000729117.1.19171 WP_000729117.1.19194 WP_000729117.1.19206 WP_000729117.1.19245 WP_000729117.1.1925 WP_000729117.1.19276 WP_000729117.1.19277 WP_000729117.1.19297 WP_000729117.1.193 WP_000729117.1.19312 WP_000729117.1.19313 WP_000729117.1.19314 WP_000729117.1.19315 WP_000729117.1.19332 WP_000729117.1.19338 WP_000729117.1.19347 WP_000729117.1.19350 WP_000729117.1.19361 WP_000729117.1.19374 WP_000729117.1.19379 WP_000729117.1.19389 WP_000729117.1.19397 WP_000729117.1.19419 WP_000729117.1.19424 WP_000729117.1.19441 WP_000729117.1.19448 WP_000729117.1.19465 WP_000729117.1.19478 WP_000729117.1.19487 WP_000729117.1.19494 WP_000729117.1.1952 WP_000729117.1.19534 WP_000729117.1.19544 WP_000729117.1.19547 WP_000729117.1.19557 WP_000729117.1.19581 WP_000729117.1.19583 WP_000729117.1.19593 WP_000729117.1.1960 WP_000729117.1.19602 WP_000729117.1.1963 WP_000729117.1.19644 WP_000729117.1.19649 WP_000729117.1.19651 WP_000729117.1.19655 WP_000729117.1.19661 WP_000729117.1.19684 WP_000729117.1.19691 WP_000729117.1.19758 WP_000729117.1.19760 WP_000729117.1.19761 WP_000729117.1.19778 WP_000729117.1.19795 WP_000729117.1.1982 WP_000729117.1.19830 WP_000729117.1.19838 WP_000729117.1.19840 WP_000729117.1.19845 WP_000729117.1.19847 WP_000729117.1.19861 WP_000729117.1.1987 WP_000729117.1.19873 WP_000729117.1.19878 WP_000729117.1.19889 WP_000729117.1.19940 WP_000729117.1.19945 WP_000729117.1.19957 WP_000729117.1.19972 WP_000729117.1.19994 WP_000729117.1.20025 WP_000729117.1.2005 WP_000729117.1.20096 WP_000729117.1.20114 WP_000729117.1.20129 WP_000729117.1.20133 WP_000729117.1.20136 WP_000729117.1.2015 WP_000729117.1.20157 WP_000729117.1.20159 WP_000729117.1.20164 WP_000729117.1.20166 WP_000729117.1.20170 WP_000729117.1.20178 WP_000729117.1.20183 WP_000729117.1.20192 WP_000729117.1.20215 WP_000729117.1.2022 WP_000729117.1.20224 WP_000729117.1.20230 WP_000729117.1.20238 WP_000729117.1.20251 WP_000729117.1.20264 WP_000729117.1.2027 WP_000729117.1.20277 WP_000729117.1.20289 WP_000729117.1.20290 WP_000729117.1.20308 WP_000729117.1.20318 WP_000729117.1.20325 WP_000729117.1.20331 WP_000729117.1.20334 WP_000729117.1.20370 WP_000729117.1.20388 WP_000729117.1.20445 WP_000729117.1.20449 WP_000729117.1.20480 WP_000729117.1.20483 WP_000729117.1.20484 WP_000729117.1.20493 WP_000729117.1.20506 WP_000729117.1.20515 WP_000729117.1.20519 WP_000729117.1.20536 WP_000729117.1.20546 WP_000729117.1.20549 WP_000729117.1.20565 WP_000729117.1.20575 WP_000729117.1.20594 WP_000729117.1.20596 WP_000729117.1.20609 WP_000729117.1.2063 WP_000729117.1.20630 WP_000729117.1.20636 WP_000729117.1.20638 WP_000729117.1.20640 WP_000729117.1.20662 WP_000729117.1.20668 WP_000729117.1.20709 WP_000729117.1.20724 WP_000729117.1.20730 WP_000729117.1.20737 WP_000729117.1.20741 WP_000729117.1.20745 WP_000729117.1.2075 WP_000729117.1.20761 WP_000729117.1.20765 WP_000729117.1.20784 WP_000729117.1.20785 WP_000729117.1.20813 WP_000729117.1.20818 WP_000729117.1.20824 WP_000729117.1.20831 WP_000729117.1.20841 WP_000729117.1.20848 WP_000729117.1.20863 WP_000729117.1.2089 WP_000729117.1.20893 WP_000729117.1.20907 WP_000729117.1.2092 WP_000729117.1.2093 WP_000729117.1.20933 WP_000729117.1.2094 WP_000729117.1.20941 WP_000729117.1.20943 WP_000729117.1.20950 WP_000729117.1.20958 WP_000729117.1.20982 WP_000729117.1.20989 WP_000729117.1.2100 WP_000729117.1.21017 WP_000729117.1.21020 WP_000729117.1.21022 WP_000729117.1.21024 WP_000729117.1.21033 WP_000729117.1.21041 WP_000729117.1.21057 WP_000729117.1.21059 WP_000729117.1.21104 WP_000729117.1.21122 WP_000729117.1.21129 WP_000729117.1.2113 WP_000729117.1.21131 WP_000729117.1.21137 WP_000729117.1.21152 WP_000729117.1.21171 WP_000729117.1.21197 WP_000729117.1.21236 WP_000729117.1.21248 WP_000729117.1.21251 WP_000729117.1.21255 WP_000729117.1.21266 WP_000729117.1.21277 WP_000729117.1.21305 WP_000729117.1.21320 WP_000729117.1.21336 WP_000729117.1.21378 WP_000729117.1.21395 WP_000729117.1.2142 WP_000729117.1.21441 WP_000729117.1.21450 WP_000729117.1.21455 WP_000729117.1.21470 WP_000729117.1.21519 WP_000729117.1.21526 WP_000729117.1.21537 WP_000729117.1.2156 WP_000729117.1.21573 WP_000729117.1.21578 WP_000729117.1.21596 WP_000729117.1.21614 WP_000729117.1.21628 WP_000729117.1.21634 WP_000729117.1.21637 WP_000729117.1.2164 WP_000729117.1.21652 WP_000729117.1.21656 WP_000729117.1.21661 WP_000729117.1.21666 WP_000729117.1.21668 WP_000729117.1.21673 WP_000729117.1.21714 WP_000729117.1.21727 WP_000729117.1.21732 WP_000729117.1.21733 WP_000729117.1.21756 WP_000729117.1.21758 WP_000729117.1.21762 WP_000729117.1.21771 WP_000729117.1.21773 WP_000729117.1.21811 WP_000729117.1.21812 WP_000729117.1.21823 WP_000729117.1.21887 WP_000729117.1.21895 WP_000729117.1.21899 WP_000729117.1.21915 WP_000729117.1.21945 WP_000729117.1.21948 WP_000729117.1.2198 WP_000729117.1.21986 WP_000729117.1.21992 WP_000729117.1.22021 WP_000729117.1.22060 WP_000729117.1.22088 WP_000729117.1.22098 WP_000729117.1.22138 WP_000729117.1.22161 WP_000729117.1.2218 WP_000729117.1.22182 WP_000729117.1.22189 WP_000729117.1.22195 WP_000729117.1.22203 WP_000729117.1.22204 WP_000729117.1.22251 WP_000729117.1.22268 WP_000729117.1.22269 WP_000729117.1.22272 WP_000729117.1.22280 WP_000729117.1.22291 WP_000729117.1.22293 WP_000729117.1.22295 WP_000729117.1.22304 WP_000729117.1.22314 WP_000729117.1.22325 WP_000729117.1.22328 WP_000729117.1.22350 WP_000729117.1.22359 WP_000729117.1.22363 WP_000729117.1.22409 WP_000729117.1.2242 WP_000729117.1.22431 WP_000729117.1.2245 WP_000729117.1.22450 WP_000729117.1.22464 WP_000729117.1.22470 WP_000729117.1.22494 WP_000729117.1.22501 WP_000729117.1.22508 WP_000729117.1.22522 WP_000729117.1.22543 WP_000729117.1.22544 WP_000729117.1.22549 WP_000729117.1.22571 WP_000729117.1.22572 WP_000729117.1.22574 WP_000729117.1.22576 WP_000729117.1.22579 WP_000729117.1.22594 WP_000729117.1.22599 WP_000729117.1.22631 WP_000729117.1.22632 WP_000729117.1.22641 WP_000729117.1.22649 WP_000729117.1.22662 WP_000729117.1.22667 WP_000729117.1.22669 WP_000729117.1.22685 WP_000729117.1.22690 WP_000729117.1.22691 WP_000729117.1.22743 WP_000729117.1.22756 WP_000729117.1.22757 WP_000729117.1.22759 WP_000729117.1.22765 WP_000729117.1.22771 WP_000729117.1.22777 WP_000729117.1.22783 WP_000729117.1.22809 WP_000729117.1.22814 WP_000729117.1.22824 WP_000729117.1.22827 WP_000729117.1.22846 WP_000729117.1.22868 WP_000729117.1.22875 WP_000729117.1.22885 WP_000729117.1.22896 WP_000729117.1.22908 WP_000729117.1.22917 WP_000729117.1.22925 WP_000729117.1.22939 WP_000729117.1.22961 WP_000729117.1.22988 WP_000729117.1.22990 WP_000729117.1.22993 WP_000729117.1.2300 WP_000729117.1.23005 WP_000729117.1.23026 WP_000729117.1.23035 WP_000729117.1.23042 WP_000729117.1.23044 WP_000729117.1.23045 WP_000729117.1.23057 WP_000729117.1.23062 WP_000729117.1.23073 WP_000729117.1.23078 WP_000729117.1.23081 WP_000729117.1.23090 WP_000729117.1.23092 WP_000729117.1.23105 WP_000729117.1.23109 WP_000729117.1.23115 WP_000729117.1.23120 WP_000729117.1.23135 WP_000729117.1.2322 WP_000729117.1.23230 WP_000729117.1.23241 WP_000729117.1.2325 WP_000729117.1.23257 WP_000729117.1.23270 WP_000729117.1.23282 WP_000729117.1.23285 WP_000729117.1.23290 WP_000729117.1.23293 WP_000729117.1.23299 WP_000729117.1.23323 WP_000729117.1.23330 WP_000729117.1.23351 WP_000729117.1.23352 WP_000729117.1.23355 WP_000729117.1.23376 WP_000729117.1.23378 WP_000729117.1.23383 WP_000729117.1.23386 WP_000729117.1.23388 WP_000729117.1.23393 WP_000729117.1.23435 WP_000729117.1.23443 WP_000729117.1.23456 WP_000729117.1.23463 WP_000729117.1.23467 WP_000729117.1.23486 WP_000729117.1.23487 WP_000729117.1.23511 WP_000729117.1.23520 WP_000729117.1.23527 WP_000729117.1.2353 WP_000729117.1.23549 WP_000729117.1.23554 WP_000729117.1.23561 WP_000729117.1.23563 WP_000729117.1.23575 WP_000729117.1.23584 WP_000729117.1.23593 WP_000729117.1.2362 WP_000729117.1.23622 WP_000729117.1.23625 WP_000729117.1.23640 WP_000729117.1.23660 WP_000729117.1.23676 WP_000729117.1.23693 WP_000729117.1.23700 WP_000729117.1.23711 WP_000729117.1.23724 WP_000729117.1.23729 WP_000729117.1.23741 WP_000729117.1.23752 WP_000729117.1.23754 WP_000729117.1.23765 WP_000729117.1.23790 WP_000729117.1.23795 WP_000729117.1.23804 WP_000729117.1.23806 WP_000729117.1.23812 WP_000729117.1.23838 WP_000729117.1.23840 WP_000729117.1.23855 WP_000729117.1.23869 WP_000729117.1.23881 WP_000729117.1.23886 WP_000729117.1.23890 WP_000729117.1.23895 WP_000729117.1.23898 WP_000729117.1.23899 WP_000729117.1.23914 WP_000729117.1.23915 WP_000729117.1.23931 WP_000729117.1.23945 WP_000729117.1.2395 WP_000729117.1.23950 WP_000729117.1.23953 WP_000729117.1.23960 WP_000729117.1.23962 WP_000729117.1.23970 WP_000729117.1.23971 WP_000729117.1.23973 WP_000729117.1.23984 WP_000729117.1.23985 WP_000729117.1.24 WP_000729117.1.24004 WP_000729117.1.24024 WP_000729117.1.24038 WP_000729117.1.24045 WP_000729117.1.24051 WP_000729117.1.24058 WP_000729117.1.24068 WP_000729117.1.24070 WP_000729117.1.24088 WP_000729117.1.24089 WP_000729117.1.24120 WP_000729117.1.24122 WP_000729117.1.24124 WP_000729117.1.24127 WP_000729117.1.2413 WP_000729117.1.24136 WP_000729117.1.2418 WP_000729117.1.24194 WP_000729117.1.24233 WP_000729117.1.24278 WP_000729117.1.2428 WP_000729117.1.24283 WP_000729117.1.24290 WP_000729117.1.2430 WP_000729117.1.24304 WP_000729117.1.24316 WP_000729117.1.2433 WP_000729117.1.24341 WP_000729117.1.24362 WP_000729117.1.2437 WP_000729117.1.24374 WP_000729117.1.24381 WP_000729117.1.24383 WP_000729117.1.24458 WP_000729117.1.24460 WP_000729117.1.24473 WP_000729117.1.24483 WP_000729117.1.24485 WP_000729117.1.2449 WP_000729117.1.24499 WP_000729117.1.24523 WP_000729117.1.24524 WP_000729117.1.24533 WP_000729117.1.24536 WP_000729117.1.24547 WP_000729117.1.2456 WP_000729117.1.24560 WP_000729117.1.24570 WP_000729117.1.24575 WP_000729117.1.24577 WP_000729117.1.24583 WP_000729117.1.24592 WP_000729117.1.24616 WP_000729117.1.24634 WP_000729117.1.24641 WP_000729117.1.24642 WP_000729117.1.24646 WP_000729117.1.24650 WP_000729117.1.2469 WP_000729117.1.24693 WP_000729117.1.24695 WP_000729117.1.24703 WP_000729117.1.24752 WP_000729117.1.24753 WP_000729117.1.24758 WP_000729117.1.24763 WP_000729117.1.24783 WP_000729117.1.2479 WP_000729117.1.24791 WP_000729117.1.24797 WP_000729117.1.24799 WP_000729117.1.24808 WP_000729117.1.24849 WP_000729117.1.24854 WP_000729117.1.24876 WP_000729117.1.24899 WP_000729117.1.24906 WP_000729117.1.24909 WP_000729117.1.24926 WP_000729117.1.24929 WP_000729117.1.24939 WP_000729117.1.24946 WP_000729117.1.24960 WP_000729117.1.24968 WP_000729117.1.24979 WP_000729117.1.24981 WP_000729117.1.24982 WP_000729117.1.24984 WP_000729117.1.2502 WP_000729117.1.25021 WP_000729117.1.25038 WP_000729117.1.25039 WP_000729117.1.2504 WP_000729117.1.25042 WP_000729117.1.25050 WP_000729117.1.25060 WP_000729117.1.25076 WP_000729117.1.25079 WP_000729117.1.25082 WP_000729117.1.25085 WP_000729117.1.25086 WP_000729117.1.25087 WP_000729117.1.25088 WP_000729117.1.25126 WP_000729117.1.25141 WP_000729117.1.25174 WP_000729117.1.25183 WP_000729117.1.25193 WP_000729117.1.25201 WP_000729117.1.25203 WP_000729117.1.25248 WP_000729117.1.25270 WP_000729117.1.25272 WP_000729117.1.25289 WP_000729117.1.25305 WP_000729117.1.2531 WP_000729117.1.25312 WP_000729117.1.25346 WP_000729117.1.2537 WP_000729117.1.25372 WP_000729117.1.25378 WP_000729117.1.25380 WP_000729117.1.254 WP_000729117.1.2540 WP_000729117.1.25403 WP_000729117.1.25414 WP_000729117.1.25420 WP_000729117.1.2543 WP_000729117.1.25446 WP_000729117.1.25480 WP_000729117.1.255 WP_000729117.1.25517 WP_000729117.1.25526 WP_000729117.1.25548 WP_000729117.1.25577 WP_000729117.1.2558 WP_000729117.1.25592 WP_000729117.1.25598 WP_000729117.1.25602 WP_000729117.1.25612 WP_000729117.1.25613 WP_000729117.1.25631 WP_000729117.1.25643 WP_000729117.1.25652 WP_000729117.1.2567 WP_000729117.1.25680 WP_000729117.1.25681 WP_000729117.1.25701 WP_000729117.1.25712 WP_000729117.1.25713 WP_000729117.1.25717 WP_000729117.1.25718 WP_000729117.1.25724 WP_000729117.1.25726 WP_000729117.1.25750 WP_000729117.1.25753 WP_000729117.1.25755 WP_000729117.1.25794 WP_000729117.1.25799 WP_000729117.1.25819 WP_000729117.1.25831 WP_000729117.1.25832 WP_000729117.1.25843 WP_000729117.1.25855 WP_000729117.1.25869 WP_000729117.1.25873 WP_000729117.1.2588 WP_000729117.1.25886 WP_000729117.1.2589 WP_000729117.1.25890 WP_000729117.1.25895 WP_000729117.1.25915 WP_000729117.1.25945 WP_000729117.1.2597 WP_000729117.1.26005 WP_000729117.1.26040 WP_000729117.1.26048 WP_000729117.1.26055 WP_000729117.1.2606 WP_000729117.1.26061 WP_000729117.1.26066 WP_000729117.1.26076 WP_000729117.1.26092 WP_000729117.1.26100 WP_000729117.1.26105 WP_000729117.1.2612 WP_000729117.1.26121 WP_000729117.1.26125 WP_000729117.1.26130 WP_000729117.1.26131 WP_000729117.1.26134 WP_000729117.1.26135 WP_000729117.1.26150 WP_000729117.1.26161 WP_000729117.1.26175 WP_000729117.1.26186 WP_000729117.1.26189 WP_000729117.1.26191 WP_000729117.1.26196 WP_000729117.1.26246 WP_000729117.1.26259 WP_000729117.1.26262 WP_000729117.1.26264 WP_000729117.1.26270 WP_000729117.1.26284 WP_000729117.1.26304 WP_000729117.1.26325 WP_000729117.1.26331 WP_000729117.1.2637 WP_000729117.1.26379 WP_000729117.1.26391 WP_000729117.1.26398 WP_000729117.1.26401 WP_000729117.1.26403 WP_000729117.1.26419 WP_000729117.1.2642 WP_000729117.1.26438 WP_000729117.1.26443 WP_000729117.1.26467 WP_000729117.1.26474 WP_000729117.1.26479 WP_000729117.1.26480 WP_000729117.1.26517 WP_000729117.1.26525 WP_000729117.1.26569 WP_000729117.1.26570 WP_000729117.1.26574 WP_000729117.1.26575 WP_000729117.1.26579 WP_000729117.1.26588 WP_000729117.1.26590 WP_000729117.1.26598 WP_000729117.1.26609 WP_000729117.1.26613 WP_000729117.1.26627 WP_000729117.1.26644 WP_000729117.1.2665 WP_000729117.1.26658 WP_000729117.1.26659 WP_000729117.1.26660 WP_000729117.1.26683 WP_000729117.1.26688 WP_000729117.1.26716 WP_000729117.1.26720 WP_000729117.1.26736 WP_000729117.1.26761 WP_000729117.1.26766 WP_000729117.1.26782 WP_000729117.1.26839 WP_000729117.1.26878 WP_000729117.1.2688 WP_000729117.1.26912 WP_000729117.1.26932 WP_000729117.1.2694 WP_000729117.1.26941 WP_000729117.1.26943 WP_000729117.1.2695 WP_000729117.1.26950 WP_000729117.1.26975 WP_000729117.1.26987 WP_000729117.1.26995 WP_000729117.1.26998 WP_000729117.1.27019 WP_000729117.1.27043 WP_000729117.1.27057 WP_000729117.1.27060 WP_000729117.1.27091 WP_000729117.1.27098 WP_000729117.1.27101 WP_000729117.1.27105 WP_000729117.1.2712 WP_000729117.1.27134 WP_000729117.1.27141 WP_000729117.1.27148 WP_000729117.1.27175 WP_000729117.1.27188 WP_000729117.1.27214 WP_000729117.1.27234 WP_000729117.1.27260 WP_000729117.1.27280 WP_000729117.1.27283 WP_000729117.1.27292 WP_000729117.1.2731 WP_000729117.1.27310 WP_000729117.1.27313 WP_000729117.1.27330 WP_000729117.1.27338 WP_000729117.1.27367 WP_000729117.1.27373 WP_000729117.1.27396 WP_000729117.1.27401 WP_000729117.1.27426 WP_000729117.1.27445 WP_000729117.1.27451 WP_000729117.1.27472 WP_000729117.1.27504 WP_000729117.1.27518 WP_000729117.1.27524 WP_000729117.1.2755 WP_000729117.1.27560 WP_000729117.1.27580 WP_000729117.1.27611 WP_000729117.1.27618 WP_000729117.1.27683 WP_000729117.1.27691 WP_000729117.1.27693 WP_000729117.1.27698 WP_000729117.1.27723 WP_000729117.1.27734 WP_000729117.1.27741 WP_000729117.1.27742 WP_000729117.1.27749 WP_000729117.1.27758 WP_000729117.1.27774 WP_000729117.1.27786 WP_000729117.1.2779 WP_000729117.1.27797 WP_000729117.1.2782 WP_000729117.1.27846 WP_000729117.1.27856 WP_000729117.1.27861 WP_000729117.1.27871 WP_000729117.1.27876 WP_000729117.1.27879 WP_000729117.1.27897 WP_000729117.1.27913 WP_000729117.1.27923 WP_000729117.1.27932 WP_000729117.1.2794 WP_000729117.1.27957 WP_000729117.1.27971 WP_000729117.1.27998 WP_000729117.1.28008 WP_000729117.1.28026 WP_000729117.1.28027 WP_000729117.1.28046 WP_000729117.1.28051 WP_000729117.1.28102 WP_000729117.1.28109 WP_000729117.1.2811 WP_000729117.1.28110 WP_000729117.1.28128 WP_000729117.1.28143 WP_000729117.1.28145 WP_000729117.1.28156 WP_000729117.1.28167 WP_000729117.1.28168 WP_000729117.1.28184 WP_000729117.1.28199 WP_000729117.1.2823 WP_000729117.1.28250 WP_000729117.1.2826 WP_000729117.1.28268 WP_000729117.1.28271 WP_000729117.1.28305 WP_000729117.1.28314 WP_000729117.1.28318 WP_000729117.1.28322 WP_000729117.1.28349 WP_000729117.1.28371 WP_000729117.1.2838 WP_000729117.1.28401 WP_000729117.1.28414 WP_000729117.1.28433 WP_000729117.1.28440 WP_000729117.1.28461 WP_000729117.1.28476 WP_000729117.1.28480 WP_000729117.1.28491 WP_000729117.1.28496 WP_000729117.1.285 WP_000729117.1.28500 WP_000729117.1.28523 WP_000729117.1.28536 WP_000729117.1.28540 WP_000729117.1.28544 WP_000729117.1.28551 WP_000729117.1.28568 WP_000729117.1.28639 WP_000729117.1.2866 WP_000729117.1.28662 WP_000729117.1.28683 WP_000729117.1.28697 WP_000729117.1.28711 WP_000729117.1.28723 WP_000729117.1.28734 WP_000729117.1.28742 WP_000729117.1.28760 WP_000729117.1.28762 WP_000729117.1.28769 WP_000729117.1.28791 WP_000729117.1.28809 WP_000729117.1.2881 WP_000729117.1.28829 WP_000729117.1.28835 WP_000729117.1.28842 WP_000729117.1.28863 WP_000729117.1.28879 WP_000729117.1.28919 WP_000729117.1.28950 WP_000729117.1.28953 WP_000729117.1.28982 WP_000729117.1.28994 WP_000729117.1.290 WP_000729117.1.29001 WP_000729117.1.29016 WP_000729117.1.29026 WP_000729117.1.29049 WP_000729117.1.29055 WP_000729117.1.29061 WP_000729117.1.29079 WP_000729117.1.29082 WP_000729117.1.291 WP_000729117.1.29100 WP_000729117.1.29118 WP_000729117.1.29125 WP_000729117.1.29126 WP_000729117.1.29128 WP_000729117.1.29146 WP_000729117.1.29150 WP_000729117.1.29164 WP_000729117.1.29176 WP_000729117.1.29194 WP_000729117.1.29197 WP_000729117.1.29202 WP_000729117.1.29206 WP_000729117.1.29221 WP_000729117.1.29230 WP_000729117.1.29239 WP_000729117.1.29252 WP_000729117.1.2926 WP_000729117.1.2931 WP_000729117.1.29377 WP_000729117.1.29394 WP_000729117.1.29404 WP_000729117.1.2942 WP_000729117.1.29429 WP_000729117.1.29443 WP_000729117.1.2945 WP_000729117.1.29486 WP_000729117.1.29495 WP_000729117.1.29497 WP_000729117.1.29503 WP_000729117.1.29504 WP_000729117.1.29513 WP_000729117.1.2952 WP_000729117.1.29523 WP_000729117.1.2954 WP_000729117.1.29556 WP_000729117.1.29564 WP_000729117.1.29590 WP_000729117.1.29597 WP_000729117.1.29603 WP_000729117.1.29618 WP_000729117.1.29643 WP_000729117.1.29647 WP_000729117.1.29662 WP_000729117.1.29669 WP_000729117.1.29683 WP_000729117.1.29689 WP_000729117.1.29699 WP_000729117.1.29715 WP_000729117.1.29724 WP_000729117.1.29740 WP_000729117.1.29746 WP_000729117.1.29752 WP_000729117.1.2978 WP_000729117.1.29798 WP_000729117.1.29812 WP_000729117.1.29815 WP_000729117.1.29818 WP_000729117.1.29819 WP_000729117.1.29820 WP_000729117.1.29821 WP_000729117.1.29840 WP_000729117.1.29855 WP_000729117.1.2986 WP_000729117.1.29874 WP_000729117.1.29876 WP_000729117.1.29884 WP_000729117.1.29933 WP_000729117.1.2995 WP_000729117.1.29967 WP_000729117.1.29976 WP_000729117.1.29979 WP_000729117.1.29992 WP_000729117.1.30 WP_000729117.1.30004 WP_000729117.1.30019 WP_000729117.1.30035 WP_000729117.1.30052 WP_000729117.1.30063 WP_000729117.1.30064 WP_000729117.1.30098 WP_000729117.1.30105 WP_000729117.1.30123 WP_000729117.1.30141 WP_000729117.1.30164 WP_000729117.1.3018 WP_000729117.1.30221 WP_000729117.1.30231 WP_000729117.1.30232 WP_000729117.1.30239 WP_000729117.1.30247 WP_000729117.1.30253 WP_000729117.1.30269 WP_000729117.1.30298 WP_000729117.1.30347 WP_000729117.1.30391 WP_000729117.1.30397 WP_000729117.1.30399 WP_000729117.1.30400 WP_000729117.1.30401 WP_000729117.1.30428 WP_000729117.1.3045 WP_000729117.1.30452 WP_000729117.1.30472 WP_000729117.1.30476 WP_000729117.1.30479 WP_000729117.1.30497 WP_000729117.1.30524 WP_000729117.1.30536 WP_000729117.1.30546 WP_000729117.1.3055 WP_000729117.1.30550 WP_000729117.1.30554 WP_000729117.1.30570 WP_000729117.1.30580 WP_000729117.1.306 WP_000729117.1.3063 WP_000729117.1.30630 WP_000729117.1.30637 WP_000729117.1.30639 WP_000729117.1.30640 WP_000729117.1.30665 WP_000729117.1.30691 WP_000729117.1.30700 WP_000729117.1.30733 WP_000729117.1.30742 WP_000729117.1.30749 WP_000729117.1.30762 WP_000729117.1.30783 WP_000729117.1.30808 WP_000729117.1.3083 WP_000729117.1.30843 WP_000729117.1.30853 WP_000729117.1.30866 WP_000729117.1.30867 WP_000729117.1.30879 WP_000729117.1.30887 WP_000729117.1.30896 WP_000729117.1.309 WP_000729117.1.30905 WP_000729117.1.30906 WP_000729117.1.30918 WP_000729117.1.30960 WP_000729117.1.30987 WP_000729117.1.30993 WP_000729117.1.30999 WP_000729117.1.31000 WP_000729117.1.31009 WP_000729117.1.31017 WP_000729117.1.31026 WP_000729117.1.31029 WP_000729117.1.31055 WP_000729117.1.31083 WP_000729117.1.31089 WP_000729117.1.31142 WP_000729117.1.31149 WP_000729117.1.31154 WP_000729117.1.31188 WP_000729117.1.312 WP_000729117.1.31211 WP_000729117.1.31252 WP_000729117.1.31295 WP_000729117.1.31347 WP_000729117.1.31353 WP_000729117.1.31357 WP_000729117.1.31379 WP_000729117.1.3140 WP_000729117.1.31401 WP_000729117.1.31407 WP_000729117.1.31419 WP_000729117.1.31421 WP_000729117.1.31422 WP_000729117.1.31429 WP_000729117.1.31431 WP_000729117.1.31433 WP_000729117.1.31434 WP_000729117.1.31482 WP_000729117.1.31506 WP_000729117.1.31511 WP_000729117.1.31518 WP_000729117.1.31521 WP_000729117.1.31527 WP_000729117.1.31542 WP_000729117.1.31557 WP_000729117.1.31559 WP_000729117.1.31575 WP_000729117.1.31596 WP_000729117.1.31614 WP_000729117.1.31618 WP_000729117.1.31625 WP_000729117.1.31639 WP_000729117.1.31675 WP_000729117.1.31679 WP_000729117.1.31681 WP_000729117.1.31696 WP_000729117.1.31709 WP_000729117.1.31715 WP_000729117.1.31736 WP_000729117.1.31740 WP_000729117.1.3176 WP_000729117.1.31801 WP_000729117.1.31803 WP_000729117.1.31809 WP_000729117.1.31823 WP_000729117.1.31825 WP_000729117.1.31835 WP_000729117.1.31839 WP_000729117.1.31860 WP_000729117.1.31863 WP_000729117.1.31866 WP_000729117.1.31898 WP_000729117.1.31899 WP_000729117.1.31903 WP_000729117.1.31924 WP_000729117.1.31928 WP_000729117.1.3193 WP_000729117.1.31937 WP_000729117.1.31956 WP_000729117.1.31978 WP_000729117.1.3201 WP_000729117.1.32020 WP_000729117.1.32021 WP_000729117.1.3203 WP_000729117.1.32030 WP_000729117.1.32037 WP_000729117.1.32049 WP_000729117.1.32063 WP_000729117.1.32078 WP_000729117.1.32089 WP_000729117.1.32091 WP_000729117.1.32093 WP_000729117.1.32094 WP_000729117.1.3212 WP_000729117.1.32121 WP_000729117.1.32127 WP_000729117.1.32138 WP_000729117.1.32142 WP_000729117.1.32143 WP_000729117.1.3215 WP_000729117.1.32173 WP_000729117.1.32184 WP_000729117.1.322 WP_000729117.1.32225 WP_000729117.1.32232 WP_000729117.1.32234 WP_000729117.1.32236 WP_000729117.1.32242 WP_000729117.1.32243 WP_000729117.1.32279 WP_000729117.1.32287 WP_000729117.1.3233 WP_000729117.1.32333 WP_000729117.1.32394 WP_000729117.1.32406 WP_000729117.1.32432 WP_000729117.1.32435 WP_000729117.1.32448 WP_000729117.1.3247 WP_000729117.1.32475 WP_000729117.1.32478 WP_000729117.1.32479 WP_000729117.1.3248 WP_000729117.1.32480 WP_000729117.1.32494 WP_000729117.1.32509 WP_000729117.1.32518 WP_000729117.1.32536 WP_000729117.1.32558 WP_000729117.1.32574 WP_000729117.1.32580 WP_000729117.1.32587 WP_000729117.1.3259 WP_000729117.1.32590 WP_000729117.1.32591 WP_000729117.1.32601 WP_000729117.1.32635 WP_000729117.1.32650 WP_000729117.1.32661 WP_000729117.1.32676 WP_000729117.1.32680 WP_000729117.1.3269 WP_000729117.1.327 WP_000729117.1.32709 WP_000729117.1.32715 WP_000729117.1.32718 WP_000729117.1.32720 WP_000729117.1.32722 WP_000729117.1.32741 WP_000729117.1.32772 WP_000729117.1.32811 WP_000729117.1.32815 WP_000729117.1.32831 WP_000729117.1.32835 WP_000729117.1.32875 WP_000729117.1.32888 WP_000729117.1.32903 WP_000729117.1.32910 WP_000729117.1.32931 WP_000729117.1.32938 WP_000729117.1.3295 WP_000729117.1.32959 WP_000729117.1.32984 WP_000729117.1.32992 WP_000729117.1.32995 WP_000729117.1.33004 WP_000729117.1.33014 WP_000729117.1.33018 WP_000729117.1.33022 WP_000729117.1.33026 WP_000729117.1.33046 WP_000729117.1.33049 WP_000729117.1.33053 WP_000729117.1.33055 WP_000729117.1.33094 WP_000729117.1.33101 WP_000729117.1.33119 WP_000729117.1.33125 WP_000729117.1.33146 WP_000729117.1.33167 WP_000729117.1.33171 WP_000729117.1.33178 WP_000729117.1.33179 WP_000729117.1.33190 WP_000729117.1.33217 WP_000729117.1.3323 WP_000729117.1.33237 WP_000729117.1.33238 WP_000729117.1.33244 WP_000729117.1.33268 WP_000729117.1.33303 WP_000729117.1.33325 WP_000729117.1.33341 WP_000729117.1.33362 WP_000729117.1.33369 WP_000729117.1.33385 WP_000729117.1.334 WP_000729117.1.33408 WP_000729117.1.33410 WP_000729117.1.33413 WP_000729117.1.33424 WP_000729117.1.33428 WP_000729117.1.3344 WP_000729117.1.33475 WP_000729117.1.33476 WP_000729117.1.33502 WP_000729117.1.33525 WP_000729117.1.33526 WP_000729117.1.3354 WP_000729117.1.33545 WP_000729117.1.33561 WP_000729117.1.33563 WP_000729117.1.33584 WP_000729117.1.33595 WP_000729117.1.33631 WP_000729117.1.33638 WP_000729117.1.33648 WP_000729117.1.33667 WP_000729117.1.33680 WP_000729117.1.33729 WP_000729117.1.33736 WP_000729117.1.33745 WP_000729117.1.33746 WP_000729117.1.33751 WP_000729117.1.33780 WP_000729117.1.33799 WP_000729117.1.33823 WP_000729117.1.33853 WP_000729117.1.33854 WP_000729117.1.33879 WP_000729117.1.33888 WP_000729117.1.33914 WP_000729117.1.33948 WP_000729117.1.33952 WP_000729117.1.33973 WP_000729117.1.33974 WP_000729117.1.33979 WP_000729117.1.3398 WP_000729117.1.33981 WP_000729117.1.34003 WP_000729117.1.3401 WP_000729117.1.34094 WP_000729117.1.34117 WP_000729117.1.34121 WP_000729117.1.34122 WP_000729117.1.34124 WP_000729117.1.34130 WP_000729117.1.34144 WP_000729117.1.3415 WP_000729117.1.342 WP_000729117.1.34204 WP_000729117.1.34206 WP_000729117.1.34208 WP_000729117.1.34224 WP_000729117.1.34269 WP_000729117.1.34270 WP_000729117.1.34273 WP_000729117.1.34277 WP_000729117.1.34294 WP_000729117.1.34303 WP_000729117.1.3432 WP_000729117.1.34332 WP_000729117.1.34341 WP_000729117.1.34348 WP_000729117.1.34362 WP_000729117.1.34363 WP_000729117.1.34380 WP_000729117.1.34383 WP_000729117.1.3439 WP_000729117.1.34397 WP_000729117.1.34400 WP_000729117.1.34422 WP_000729117.1.3444 WP_000729117.1.34440 WP_000729117.1.34441 WP_000729117.1.34444 WP_000729117.1.34456 WP_000729117.1.34464 WP_000729117.1.34470 WP_000729117.1.34525 WP_000729117.1.34528 WP_000729117.1.34532 WP_000729117.1.34538 WP_000729117.1.34541 WP_000729117.1.34557 WP_000729117.1.34558 WP_000729117.1.3460 WP_000729117.1.34605 WP_000729117.1.34655 WP_000729117.1.34668 WP_000729117.1.34675 WP_000729117.1.34680 WP_000729117.1.34682 WP_000729117.1.34683 WP_000729117.1.34686 WP_000729117.1.3469 WP_000729117.1.347 WP_000729117.1.3472 WP_000729117.1.34781 WP_000729117.1.34782 WP_000729117.1.34794 WP_000729117.1.34827 WP_000729117.1.34835 WP_000729117.1.34838 WP_000729117.1.34855 WP_000729117.1.34875 WP_000729117.1.34887 WP_000729117.1.34913 WP_000729117.1.34931 WP_000729117.1.34948 WP_000729117.1.34966 WP_000729117.1.34982 WP_000729117.1.34983 WP_000729117.1.34990 WP_000729117.1.34993 WP_000729117.1.35003 WP_000729117.1.35006 WP_000729117.1.35007 WP_000729117.1.35012 WP_000729117.1.35039 WP_000729117.1.35114 WP_000729117.1.35127 WP_000729117.1.35132 WP_000729117.1.3515 WP_000729117.1.35168 WP_000729117.1.35180 WP_000729117.1.35186 WP_000729117.1.35195 WP_000729117.1.35198 WP_000729117.1.35204 WP_000729117.1.35208 WP_000729117.1.3521 WP_000729117.1.35211 WP_000729117.1.35220 WP_000729117.1.35253 WP_000729117.1.35258 WP_000729117.1.35316 WP_000729117.1.35360 WP_000729117.1.35365 WP_000729117.1.35368 WP_000729117.1.35376 WP_000729117.1.3539 WP_000729117.1.35393 WP_000729117.1.35394 WP_000729117.1.35398 WP_000729117.1.35448 WP_000729117.1.35464 WP_000729117.1.35465 WP_000729117.1.35466 WP_000729117.1.35468 WP_000729117.1.35483 WP_000729117.1.3550 WP_000729117.1.35552 WP_000729117.1.35578 WP_000729117.1.35581 WP_000729117.1.3560 WP_000729117.1.35604 WP_000729117.1.35627 WP_000729117.1.35632 WP_000729117.1.35651 WP_000729117.1.35653 WP_000729117.1.35654 WP_000729117.1.35698 WP_000729117.1.35704 WP_000729117.1.35724 WP_000729117.1.35740 WP_000729117.1.35741 WP_000729117.1.35744 WP_000729117.1.35789 WP_000729117.1.35889 WP_000729117.1.35904 WP_000729117.1.35922 WP_000729117.1.35927 WP_000729117.1.35934 WP_000729117.1.35942 WP_000729117.1.35959 WP_000729117.1.35963 WP_000729117.1.3598 WP_000729117.1.35983 WP_000729117.1.35987 WP_000729117.1.35990 WP_000729117.1.3600 WP_000729117.1.36010 WP_000729117.1.36040 WP_000729117.1.36042 WP_000729117.1.36070 WP_000729117.1.36071 WP_000729117.1.36085 WP_000729117.1.36094 WP_000729117.1.36105 WP_000729117.1.36129 WP_000729117.1.36132 WP_000729117.1.36158 WP_000729117.1.36159 WP_000729117.1.36164 WP_000729117.1.36166 WP_000729117.1.36177 WP_000729117.1.36182 WP_000729117.1.36207 WP_000729117.1.36212 WP_000729117.1.3624 WP_000729117.1.36281 WP_000729117.1.36299 WP_000729117.1.36332 WP_000729117.1.36334 WP_000729117.1.36352 WP_000729117.1.36386 WP_000729117.1.36405 WP_000729117.1.36412 WP_000729117.1.36414 WP_000729117.1.36426 WP_000729117.1.3643 WP_000729117.1.36459 WP_000729117.1.36496 WP_000729117.1.365 WP_000729117.1.36500 WP_000729117.1.36507 WP_000729117.1.36523 WP_000729117.1.36537 WP_000729117.1.36545 WP_000729117.1.36610 WP_000729117.1.36626 WP_000729117.1.36627 WP_000729117.1.36628 WP_000729117.1.36667 WP_000729117.1.3668 WP_000729117.1.36699 WP_000729117.1.36707 WP_000729117.1.3671 WP_000729117.1.36724 WP_000729117.1.36739 WP_000729117.1.36746 WP_000729117.1.36747 WP_000729117.1.36761 WP_000729117.1.36767 WP_000729117.1.36799 WP_000729117.1.36806 WP_000729117.1.36812 WP_000729117.1.36817 WP_000729117.1.36826 WP_000729117.1.36833 WP_000729117.1.36856 WP_000729117.1.36886 WP_000729117.1.36904 WP_000729117.1.36925 WP_000729117.1.3697 WP_000729117.1.36971 WP_000729117.1.36975 WP_000729117.1.37006 WP_000729117.1.37020 WP_000729117.1.37032 WP_000729117.1.37046 WP_000729117.1.37049 WP_000729117.1.37057 WP_000729117.1.37076 WP_000729117.1.37099 WP_000729117.1.37101 WP_000729117.1.37102 WP_000729117.1.37103 WP_000729117.1.37122 WP_000729117.1.37146 WP_000729117.1.37153 WP_000729117.1.37155 WP_000729117.1.37206 WP_000729117.1.37226 WP_000729117.1.3723 WP_000729117.1.37233 WP_000729117.1.37252 WP_000729117.1.37261 WP_000729117.1.37266 WP_000729117.1.37290 WP_000729117.1.3730 WP_000729117.1.37306 WP_000729117.1.37312 WP_000729117.1.37313 WP_000729117.1.37329 WP_000729117.1.37334 WP_000729117.1.37337 WP_000729117.1.37342 WP_000729117.1.37352 WP_000729117.1.37360 WP_000729117.1.37371 WP_000729117.1.37372 WP_000729117.1.37419 WP_000729117.1.37423 WP_000729117.1.37433 WP_000729117.1.37445 WP_000729117.1.37472 WP_000729117.1.37476 WP_000729117.1.37477 WP_000729117.1.37485 WP_000729117.1.3749 WP_000729117.1.37510 WP_000729117.1.37516 WP_000729117.1.37538 WP_000729117.1.37543 WP_000729117.1.37544 WP_000729117.1.37548 WP_000729117.1.37549 WP_000729117.1.37550 WP_000729117.1.37554 WP_000729117.1.37576 WP_000729117.1.37588 WP_000729117.1.37592 WP_000729117.1.37608 WP_000729117.1.3762 WP_000729117.1.37634 WP_000729117.1.37637 WP_000729117.1.37664 WP_000729117.1.377 WP_000729117.1.3772 WP_000729117.1.37730 WP_000729117.1.37731 WP_000729117.1.37736 WP_000729117.1.37745 WP_000729117.1.37750 WP_000729117.1.37758 WP_000729117.1.37762 WP_000729117.1.37766 WP_000729117.1.37769 WP_000729117.1.37773 WP_000729117.1.37817 WP_000729117.1.37830 WP_000729117.1.37847 WP_000729117.1.37852 WP_000729117.1.37853 WP_000729117.1.3788 WP_000729117.1.37880 WP_000729117.1.37887 WP_000729117.1.37897 WP_000729117.1.37917 WP_000729117.1.37923 WP_000729117.1.37926 WP_000729117.1.37940 WP_000729117.1.3795 WP_000729117.1.3796 WP_000729117.1.37962 WP_000729117.1.37967 WP_000729117.1.37984 WP_000729117.1.37995 WP_000729117.1.37998 WP_000729117.1.38000 WP_000729117.1.38033 WP_000729117.1.38043 WP_000729117.1.38050 WP_000729117.1.38063 WP_000729117.1.38080 WP_000729117.1.38081 WP_000729117.1.38085 WP_000729117.1.38103 WP_000729117.1.38105 WP_000729117.1.38107 WP_000729117.1.3811 WP_000729117.1.38119 WP_000729117.1.38120 WP_000729117.1.3815 WP_000729117.1.38155 WP_000729117.1.38182 WP_000729117.1.38185 WP_000729117.1.38202 WP_000729117.1.38211 WP_000729117.1.3822 WP_000729117.1.38234 WP_000729117.1.38257 WP_000729117.1.38264 WP_000729117.1.38293 WP_000729117.1.38300 WP_000729117.1.38306 WP_000729117.1.38314 WP_000729117.1.38323 WP_000729117.1.38371 WP_000729117.1.38392 WP_000729117.1.38412 WP_000729117.1.38419 WP_000729117.1.38485 WP_000729117.1.38533 WP_000729117.1.38544 WP_000729117.1.38561 WP_000729117.1.38567 WP_000729117.1.38584 WP_000729117.1.38610 WP_000729117.1.38626 WP_000729117.1.38629 WP_000729117.1.38636 WP_000729117.1.38694 WP_000729117.1.38722 WP_000729117.1.3873 WP_000729117.1.38751 WP_000729117.1.38777 WP_000729117.1.38782 WP_000729117.1.38811 WP_000729117.1.38827 WP_000729117.1.38835 WP_000729117.1.38843 WP_000729117.1.38896 WP_000729117.1.389 WP_000729117.1.38911 WP_000729117.1.38920 WP_000729117.1.38935 WP_000729117.1.38937 WP_000729117.1.38950 WP_000729117.1.38956 WP_000729117.1.38958 WP_000729117.1.39005 WP_000729117.1.39015 WP_000729117.1.3903 WP_000729117.1.39037 WP_000729117.1.3904 WP_000729117.1.39063 WP_000729117.1.39103 WP_000729117.1.39111 WP_000729117.1.3912 WP_000729117.1.39123 WP_000729117.1.39148 WP_000729117.1.39150 WP_000729117.1.39155 WP_000729117.1.39157 WP_000729117.1.39164 WP_000729117.1.39167 WP_000729117.1.39180 WP_000729117.1.39184 WP_000729117.1.39196 WP_000729117.1.3921 WP_000729117.1.3922 WP_000729117.1.39249 WP_000729117.1.39254 WP_000729117.1.39286 WP_000729117.1.39289 WP_000729117.1.39302 WP_000729117.1.39310 WP_000729117.1.39313 WP_000729117.1.39325 WP_000729117.1.39327 WP_000729117.1.39342 WP_000729117.1.39356 WP_000729117.1.39358 WP_000729117.1.39365 WP_000729117.1.39367 WP_000729117.1.39373 WP_000729117.1.39377 WP_000729117.1.39401 WP_000729117.1.39402 WP_000729117.1.39415 WP_000729117.1.39430 WP_000729117.1.39468 WP_000729117.1.39481 WP_000729117.1.39492 WP_000729117.1.39509 WP_000729117.1.39531 WP_000729117.1.3954 WP_000729117.1.39541 WP_000729117.1.39564 WP_000729117.1.39575 WP_000729117.1.39580 WP_000729117.1.39594 WP_000729117.1.39601 WP_000729117.1.39606 WP_000729117.1.39607 WP_000729117.1.39610 WP_000729117.1.39626 WP_000729117.1.39636 WP_000729117.1.39646 WP_000729117.1.39651 WP_000729117.1.39690 WP_000729117.1.3970 WP_000729117.1.39708 WP_000729117.1.39709 WP_000729117.1.39713 WP_000729117.1.39715 WP_000729117.1.39726 WP_000729117.1.39730 WP_000729117.1.39733 WP_000729117.1.39734 WP_000729117.1.39758 WP_000729117.1.39780 WP_000729117.1.39796 WP_000729117.1.3980 WP_000729117.1.39809 WP_000729117.1.39818 WP_000729117.1.39820 WP_000729117.1.39822 WP_000729117.1.39829 WP_000729117.1.39867 WP_000729117.1.39892 WP_000729117.1.39938 WP_000729117.1.39966 WP_000729117.1.39970 WP_000729117.1.39973 WP_000729117.1.39992 WP_000729117.1.39998 WP_000729117.1.40 WP_000729117.1.40016 WP_000729117.1.40019 WP_000729117.1.4005 WP_000729117.1.40083 WP_000729117.1.40088 WP_000729117.1.40107 WP_000729117.1.40113 WP_000729117.1.40121 WP_000729117.1.40147 WP_000729117.1.40153 WP_000729117.1.40159 WP_000729117.1.40183 WP_000729117.1.40190 WP_000729117.1.40192 WP_000729117.1.4020 WP_000729117.1.40206 WP_000729117.1.40211 WP_000729117.1.40212 WP_000729117.1.40218 WP_000729117.1.40234 WP_000729117.1.40238 WP_000729117.1.40249 WP_000729117.1.40298 WP_000729117.1.4030 WP_000729117.1.40300 WP_000729117.1.40315 WP_000729117.1.40317 WP_000729117.1.40319 WP_000729117.1.40345 WP_000729117.1.40349 WP_000729117.1.40360 WP_000729117.1.40382 WP_000729117.1.40389 WP_000729117.1.40391 WP_000729117.1.40403 WP_000729117.1.40445 WP_000729117.1.40486 WP_000729117.1.4049 WP_000729117.1.40499 WP_000729117.1.40502 WP_000729117.1.40509 WP_000729117.1.40524 WP_000729117.1.40539 WP_000729117.1.40548 WP_000729117.1.40549 WP_000729117.1.40560 WP_000729117.1.40563 WP_000729117.1.40596 WP_000729117.1.40599 WP_000729117.1.406 WP_000729117.1.40607 WP_000729117.1.40617 WP_000729117.1.40623 WP_000729117.1.40629 WP_000729117.1.40636 WP_000729117.1.40657 WP_000729117.1.40660 WP_000729117.1.40666 WP_000729117.1.40668 WP_000729117.1.40686 WP_000729117.1.40712 WP_000729117.1.40715 WP_000729117.1.40742 WP_000729117.1.40758 WP_000729117.1.40781 WP_000729117.1.40793 WP_000729117.1.4081 WP_000729117.1.40815 WP_000729117.1.4082 WP_000729117.1.40833 WP_000729117.1.40842 WP_000729117.1.40843 WP_000729117.1.40865 WP_000729117.1.40882 WP_000729117.1.40893 WP_000729117.1.40898 WP_000729117.1.40900 WP_000729117.1.40912 WP_000729117.1.40937 WP_000729117.1.40952 WP_000729117.1.40965 WP_000729117.1.4103 WP_000729117.1.41037 WP_000729117.1.41041 WP_000729117.1.41045 WP_000729117.1.41060 WP_000729117.1.41063 WP_000729117.1.41078 WP_000729117.1.41113 WP_000729117.1.41125 WP_000729117.1.41147 WP_000729117.1.41206 WP_000729117.1.41230 WP_000729117.1.41239 WP_000729117.1.41244 WP_000729117.1.41259 WP_000729117.1.4126 WP_000729117.1.41263 WP_000729117.1.41271 WP_000729117.1.41287 WP_000729117.1.41294 WP_000729117.1.41330 WP_000729117.1.41339 WP_000729117.1.41346 WP_000729117.1.41363 WP_000729117.1.41368 WP_000729117.1.41371 WP_000729117.1.41372 WP_000729117.1.41391 WP_000729117.1.41392 WP_000729117.1.41394 WP_000729117.1.41401 WP_000729117.1.41402 WP_000729117.1.41407 WP_000729117.1.41417 WP_000729117.1.4142 WP_000729117.1.41436 WP_000729117.1.41449 WP_000729117.1.41453 WP_000729117.1.41455 WP_000729117.1.41457 WP_000729117.1.41466 WP_000729117.1.41478 WP_000729117.1.41479 WP_000729117.1.41481 WP_000729117.1.41482 WP_000729117.1.41483 WP_000729117.1.41484 WP_000729117.1.41488 WP_000729117.1.41513 WP_000729117.1.41530 WP_000729117.1.41536 WP_000729117.1.41545 WP_000729117.1.41556 WP_000729117.1.41566 WP_000729117.1.4158 WP_000729117.1.41606 WP_000729117.1.41613 WP_000729117.1.41651 WP_000729117.1.41654 WP_000729117.1.41712 WP_000729117.1.41718 WP_000729117.1.4172 WP_000729117.1.41734 WP_000729117.1.41740 WP_000729117.1.41741 WP_000729117.1.41752 WP_000729117.1.41778 WP_000729117.1.41780 WP_000729117.1.41783 WP_000729117.1.41784 WP_000729117.1.41809 WP_000729117.1.41812 WP_000729117.1.41813 WP_000729117.1.41822 WP_000729117.1.41837 WP_000729117.1.41847 WP_000729117.1.41849 WP_000729117.1.41884 WP_000729117.1.41885 WP_000729117.1.4189 WP_000729117.1.41923 WP_000729117.1.4193 WP_000729117.1.41956 WP_000729117.1.41960 WP_000729117.1.41964 WP_000729117.1.41988 WP_000729117.1.41990 WP_000729117.1.41991 WP_000729117.1.42022 WP_000729117.1.42027 WP_000729117.1.42036 WP_000729117.1.42038 WP_000729117.1.42044 WP_000729117.1.42060 WP_000729117.1.42073 WP_000729117.1.42095 WP_000729117.1.42096 WP_000729117.1.42113 WP_000729117.1.4213 WP_000729117.1.42138 WP_000729117.1.4214 WP_000729117.1.42151 WP_000729117.1.42159 WP_000729117.1.42179 WP_000729117.1.42191 WP_000729117.1.42203 WP_000729117.1.42209 WP_000729117.1.42214 WP_000729117.1.42221 WP_000729117.1.42226 WP_000729117.1.42228 WP_000729117.1.4224 WP_000729117.1.42252 WP_000729117.1.42258 WP_000729117.1.42277 WP_000729117.1.42284 WP_000729117.1.42300 WP_000729117.1.42318 WP_000729117.1.42350 WP_000729117.1.42359 WP_000729117.1.42367 WP_000729117.1.42369 WP_000729117.1.42376 WP_000729117.1.42413 WP_000729117.1.42415 WP_000729117.1.4242 WP_000729117.1.42432 WP_000729117.1.42442 WP_000729117.1.42443 WP_000729117.1.42447 WP_000729117.1.42448 WP_000729117.1.42456 WP_000729117.1.42480 WP_000729117.1.4250 WP_000729117.1.42513 WP_000729117.1.42516 WP_000729117.1.42522 WP_000729117.1.42547 WP_000729117.1.42586 WP_000729117.1.42594 WP_000729117.1.42597 WP_000729117.1.42600 WP_000729117.1.42601 WP_000729117.1.4261 WP_000729117.1.42632 WP_000729117.1.42638 WP_000729117.1.42661 WP_000729117.1.42669 WP_000729117.1.42670 WP_000729117.1.42677 WP_000729117.1.42709 WP_000729117.1.42728 WP_000729117.1.42748 WP_000729117.1.42749 WP_000729117.1.42750 WP_000729117.1.42756 WP_000729117.1.42761 WP_000729117.1.42770 WP_000729117.1.42771 WP_000729117.1.42791 WP_000729117.1.42804 WP_000729117.1.42808 WP_000729117.1.42813 WP_000729117.1.4282 WP_000729117.1.42828 WP_000729117.1.42830 WP_000729117.1.42832 WP_000729117.1.42863 WP_000729117.1.42879 WP_000729117.1.42891 WP_000729117.1.4290 WP_000729117.1.42903 WP_000729117.1.42918 WP_000729117.1.42936 WP_000729117.1.42937 WP_000729117.1.42950 WP_000729117.1.42962 WP_000729117.1.42966 WP_000729117.1.42970 WP_000729117.1.42987 WP_000729117.1.42989 WP_000729117.1.42991 WP_000729117.1.43013 WP_000729117.1.43027 WP_000729117.1.43035 WP_000729117.1.43079 WP_000729117.1.43121 WP_000729117.1.43123 WP_000729117.1.4313 WP_000729117.1.43132 WP_000729117.1.43133 WP_000729117.1.43137 WP_000729117.1.43140 WP_000729117.1.43166 WP_000729117.1.43170 WP_000729117.1.43174 WP_000729117.1.43177 WP_000729117.1.43196 WP_000729117.1.43213 WP_000729117.1.43216 WP_000729117.1.43239 WP_000729117.1.43270 WP_000729117.1.43278 WP_000729117.1.43316 WP_000729117.1.43324 WP_000729117.1.4334 WP_000729117.1.43363 WP_000729117.1.43374 WP_000729117.1.43384 WP_000729117.1.4342 WP_000729117.1.43422 WP_000729117.1.43427 WP_000729117.1.4343 WP_000729117.1.43444 WP_000729117.1.43448 WP_000729117.1.43455 WP_000729117.1.43469 WP_000729117.1.43473 WP_000729117.1.43474 WP_000729117.1.43489 WP_000729117.1.43536 WP_000729117.1.4356 WP_000729117.1.43561 WP_000729117.1.43566 WP_000729117.1.43598 WP_000729117.1.436 WP_000729117.1.43604 WP_000729117.1.43622 WP_000729117.1.43642 WP_000729117.1.43720 WP_000729117.1.43733 WP_000729117.1.43738 WP_000729117.1.43750 WP_000729117.1.43754 WP_000729117.1.43769 WP_000729117.1.43798 WP_000729117.1.43803 WP_000729117.1.43804 WP_000729117.1.43837 WP_000729117.1.43898 WP_000729117.1.43911 WP_000729117.1.43925 WP_000729117.1.43939 WP_000729117.1.43942 WP_000729117.1.43953 WP_000729117.1.43966 WP_000729117.1.43989 WP_000729117.1.440 WP_000729117.1.4400 WP_000729117.1.44018 WP_000729117.1.44020 WP_000729117.1.44029 WP_000729117.1.44040 WP_000729117.1.44051 WP_000729117.1.44075 WP_000729117.1.44077 WP_000729117.1.44088 WP_000729117.1.44100 WP_000729117.1.4411 WP_000729117.1.44115 WP_000729117.1.44125 WP_000729117.1.44130 WP_000729117.1.4415 WP_000729117.1.44162 WP_000729117.1.44165 WP_000729117.1.44166 WP_000729117.1.44201 WP_000729117.1.44203 WP_000729117.1.44211 WP_000729117.1.44222 WP_000729117.1.44238 WP_000729117.1.44251 WP_000729117.1.44263 WP_000729117.1.44264 WP_000729117.1.44273 WP_000729117.1.44285 WP_000729117.1.44287 WP_000729117.1.44292 WP_000729117.1.44314 WP_000729117.1.44324 WP_000729117.1.44327 WP_000729117.1.44354 WP_000729117.1.44365 WP_000729117.1.44394 WP_000729117.1.44422 WP_000729117.1.44424 WP_000729117.1.44426 WP_000729117.1.44445 WP_000729117.1.44447 WP_000729117.1.4445 WP_000729117.1.44452 WP_000729117.1.44458 WP_000729117.1.44460 WP_000729117.1.44461 WP_000729117.1.44488 WP_000729117.1.4449 WP_000729117.1.44524 WP_000729117.1.44539 WP_000729117.1.4454 WP_000729117.1.44558 WP_000729117.1.44561 WP_000729117.1.44570 WP_000729117.1.44587 WP_000729117.1.4459 WP_000729117.1.44608 WP_000729117.1.44622 WP_000729117.1.44627 WP_000729117.1.4463 WP_000729117.1.44642 WP_000729117.1.44649 WP_000729117.1.44661 WP_000729117.1.44668 WP_000729117.1.44671 WP_000729117.1.44686 WP_000729117.1.4471 WP_000729117.1.44717 WP_000729117.1.44724 WP_000729117.1.44733 WP_000729117.1.44756 WP_000729117.1.44759 WP_000729117.1.44784 WP_000729117.1.448 WP_000729117.1.44800 WP_000729117.1.44814 WP_000729117.1.44818 WP_000729117.1.44821 WP_000729117.1.44836 WP_000729117.1.44840 WP_000729117.1.44841 WP_000729117.1.44843 WP_000729117.1.44849 WP_000729117.1.44854 WP_000729117.1.44855 WP_000729117.1.44857 WP_000729117.1.44906 WP_000729117.1.44923 WP_000729117.1.44954 WP_000729117.1.44960 WP_000729117.1.44961 WP_000729117.1.44975 WP_000729117.1.44977 WP_000729117.1.44980 WP_000729117.1.45000 WP_000729117.1.45020 WP_000729117.1.45025 WP_000729117.1.45028 WP_000729117.1.45043 WP_000729117.1.45053 WP_000729117.1.45068 WP_000729117.1.45076 WP_000729117.1.45104 WP_000729117.1.45116 WP_000729117.1.45153 WP_000729117.1.45156 WP_000729117.1.4516 WP_000729117.1.45190 WP_000729117.1.45195 WP_000729117.1.45208 WP_000729117.1.4524 WP_000729117.1.45246 WP_000729117.1.45293 WP_000729117.1.4530 WP_000729117.1.45301 WP_000729117.1.45313 WP_000729117.1.45329 WP_000729117.1.4535 WP_000729117.1.45359 WP_000729117.1.4538 WP_000729117.1.45392 WP_000729117.1.45404 WP_000729117.1.45405 WP_000729117.1.4541 WP_000729117.1.45440 WP_000729117.1.45444 WP_000729117.1.45486 WP_000729117.1.4549 WP_000729117.1.45494 WP_000729117.1.45500 WP_000729117.1.45536 WP_000729117.1.45538 WP_000729117.1.45565 WP_000729117.1.45575 WP_000729117.1.45581 WP_000729117.1.45595 WP_000729117.1.45600 WP_000729117.1.45627 WP_000729117.1.4563 WP_000729117.1.45664 WP_000729117.1.45674 WP_000729117.1.45676 WP_000729117.1.4570 WP_000729117.1.45707 WP_000729117.1.4574 WP_000729117.1.45740 WP_000729117.1.45741 WP_000729117.1.45752 WP_000729117.1.4576 WP_000729117.1.45789 WP_000729117.1.45793 WP_000729117.1.45799 WP_000729117.1.45801 WP_000729117.1.45806 WP_000729117.1.4583 WP_000729117.1.45840 WP_000729117.1.45841 WP_000729117.1.45846 WP_000729117.1.45865 WP_000729117.1.45868 WP_000729117.1.45891 WP_000729117.1.45901 WP_000729117.1.45921 WP_000729117.1.4593 WP_000729117.1.45931 WP_000729117.1.45933 WP_000729117.1.45941 WP_000729117.1.45949 WP_000729117.1.45960 WP_000729117.1.45962 WP_000729117.1.45968 WP_000729117.1.45990 WP_000729117.1.45991 WP_000729117.1.4600 WP_000729117.1.46016 WP_000729117.1.46026 WP_000729117.1.46027 WP_000729117.1.46048 WP_000729117.1.46049 WP_000729117.1.46070 WP_000729117.1.46081 WP_000729117.1.4610 WP_000729117.1.46105 WP_000729117.1.46115 WP_000729117.1.46122 WP_000729117.1.4613 WP_000729117.1.46164 WP_000729117.1.4617 WP_000729117.1.46186 WP_000729117.1.4619 WP_000729117.1.46197 WP_000729117.1.46213 WP_000729117.1.46217 WP_000729117.1.46239 WP_000729117.1.46245 WP_000729117.1.46257 WP_000729117.1.46263 WP_000729117.1.46282 WP_000729117.1.46283 WP_000729117.1.46291 WP_000729117.1.46325 WP_000729117.1.46329 WP_000729117.1.46369 WP_000729117.1.46379 WP_000729117.1.46414 WP_000729117.1.46429 WP_000729117.1.4643 WP_000729117.1.46433 WP_000729117.1.46438 WP_000729117.1.46441 WP_000729117.1.46451 WP_000729117.1.4646 WP_000729117.1.46468 WP_000729117.1.4647 WP_000729117.1.46477 WP_000729117.1.46487 WP_000729117.1.46503 WP_000729117.1.46526 WP_000729117.1.46531 WP_000729117.1.46541 WP_000729117.1.46555 WP_000729117.1.4657 WP_000729117.1.46573 WP_000729117.1.46582 WP_000729117.1.46594 WP_000729117.1.46597 WP_000729117.1.46602 WP_000729117.1.46611 WP_000729117.1.46614 WP_000729117.1.46616 WP_000729117.1.46626 WP_000729117.1.46643 WP_000729117.1.46655 WP_000729117.1.46668 WP_000729117.1.4670 WP_000729117.1.46734 WP_000729117.1.46743 WP_000729117.1.46798 WP_000729117.1.46802 WP_000729117.1.46806 WP_000729117.1.46810 WP_000729117.1.46820 WP_000729117.1.46821 WP_000729117.1.46832 WP_000729117.1.46833 WP_000729117.1.46841 WP_000729117.1.46857 WP_000729117.1.46860 WP_000729117.1.46876 WP_000729117.1.46882 WP_000729117.1.46898 WP_000729117.1.46909 WP_000729117.1.4691 WP_000729117.1.46912 WP_000729117.1.46913 WP_000729117.1.46932 WP_000729117.1.4695 WP_000729117.1.46990 WP_000729117.1.46991 WP_000729117.1.46994 WP_000729117.1.46999 WP_000729117.1.47028 WP_000729117.1.47030 WP_000729117.1.47034 WP_000729117.1.47038 WP_000729117.1.47039 WP_000729117.1.47047 WP_000729117.1.47048 WP_000729117.1.47050 WP_000729117.1.47054 WP_000729117.1.47063 WP_000729117.1.47069 WP_000729117.1.47073 WP_000729117.1.4708 WP_000729117.1.47124 WP_000729117.1.47135 WP_000729117.1.47140 WP_000729117.1.47156 WP_000729117.1.47167 WP_000729117.1.47171 WP_000729117.1.47186 WP_000729117.1.47189 WP_000729117.1.47197 WP_000729117.1.47198 WP_000729117.1.4722 WP_000729117.1.4723 WP_000729117.1.47235 WP_000729117.1.47246 WP_000729117.1.47247 WP_000729117.1.4725 WP_000729117.1.47280 WP_000729117.1.47307 WP_000729117.1.47316 WP_000729117.1.47319 WP_000729117.1.47322 WP_000729117.1.47332 WP_000729117.1.47344 WP_000729117.1.47349 WP_000729117.1.47350 WP_000729117.1.47356 WP_000729117.1.47363 WP_000729117.1.47366 WP_000729117.1.47370 WP_000729117.1.47386 WP_000729117.1.47398 WP_000729117.1.4740 WP_000729117.1.47401 WP_000729117.1.47411 WP_000729117.1.47414 WP_000729117.1.47416 WP_000729117.1.47425 WP_000729117.1.4743 WP_000729117.1.47451 WP_000729117.1.47454 WP_000729117.1.47464 WP_000729117.1.47473 WP_000729117.1.47477 WP_000729117.1.47488 WP_000729117.1.47496 WP_000729117.1.47498 WP_000729117.1.47500 WP_000729117.1.47529 WP_000729117.1.47533 WP_000729117.1.47546 WP_000729117.1.47555 WP_000729117.1.47582 WP_000729117.1.47599 WP_000729117.1.47634 WP_000729117.1.47646 WP_000729117.1.47654 WP_000729117.1.47673 WP_000729117.1.4772 WP_000729117.1.47722 WP_000729117.1.4773 WP_000729117.1.47734 WP_000729117.1.47740 WP_000729117.1.47744 WP_000729117.1.47761 WP_000729117.1.47764 WP_000729117.1.47765 WP_000729117.1.47775 WP_000729117.1.47784 WP_000729117.1.47790 WP_000729117.1.47791 WP_000729117.1.47820 WP_000729117.1.47827 WP_000729117.1.4783 WP_000729117.1.47848 WP_000729117.1.4785 WP_000729117.1.47884 WP_000729117.1.47914 WP_000729117.1.47935 WP_000729117.1.47954 WP_000729117.1.4796 WP_000729117.1.47962 WP_000729117.1.47976 WP_000729117.1.47981 WP_000729117.1.47983 WP_000729117.1.47994 WP_000729117.1.48000 WP_000729117.1.48018 WP_000729117.1.48029 WP_000729117.1.48040 WP_000729117.1.48048 WP_000729117.1.48051 WP_000729117.1.48065 WP_000729117.1.48073 WP_000729117.1.48077 WP_000729117.1.48080 WP_000729117.1.48087 WP_000729117.1.48090 WP_000729117.1.48096 WP_000729117.1.4811 WP_000729117.1.48111 WP_000729117.1.4812 WP_000729117.1.48121 WP_000729117.1.48144 WP_000729117.1.48168 WP_000729117.1.48176 WP_000729117.1.48194 WP_000729117.1.48200 WP_000729117.1.48203 WP_000729117.1.48216 WP_000729117.1.48222 WP_000729117.1.48226 WP_000729117.1.48229 WP_000729117.1.48258 WP_000729117.1.4826 WP_000729117.1.48265 WP_000729117.1.48285 WP_000729117.1.48290 WP_000729117.1.48291 WP_000729117.1.48317 WP_000729117.1.48353 WP_000729117.1.48355 WP_000729117.1.48371 WP_000729117.1.48385 WP_000729117.1.48404 WP_000729117.1.48417 WP_000729117.1.48421 WP_000729117.1.48431 WP_000729117.1.48433 WP_000729117.1.48469 WP_000729117.1.48477 WP_000729117.1.48480 WP_000729117.1.48483 WP_000729117.1.48505 WP_000729117.1.48522 WP_000729117.1.4857 WP_000729117.1.48571 WP_000729117.1.48590 WP_000729117.1.486 WP_000729117.1.48602 WP_000729117.1.48615 WP_000729117.1.48620 WP_000729117.1.48626 WP_000729117.1.48629 WP_000729117.1.48678 WP_000729117.1.48689 WP_000729117.1.48697 WP_000729117.1.4871 WP_000729117.1.48712 WP_000729117.1.4876 WP_000729117.1.48771 WP_000729117.1.48792 WP_000729117.1.48801 WP_000729117.1.48806 WP_000729117.1.48808 WP_000729117.1.48825 WP_000729117.1.48827 WP_000729117.1.48847 WP_000729117.1.48860 WP_000729117.1.48901 WP_000729117.1.48902 WP_000729117.1.48907 WP_000729117.1.48910 WP_000729117.1.4892 WP_000729117.1.48926 WP_000729117.1.48928 WP_000729117.1.48954 WP_000729117.1.48970 WP_000729117.1.48974 WP_000729117.1.49001 WP_000729117.1.49061 WP_000729117.1.49076 WP_000729117.1.49104 WP_000729117.1.49107 WP_000729117.1.49124 WP_000729117.1.49136 WP_000729117.1.49147 WP_000729117.1.49170 WP_000729117.1.49179 WP_000729117.1.49190 WP_000729117.1.49229 WP_000729117.1.49243 WP_000729117.1.49258 WP_000729117.1.49259 WP_000729117.1.49275 WP_000729117.1.4931 WP_000729117.1.49312 WP_000729117.1.49321 WP_000729117.1.49332 WP_000729117.1.49336 WP_000729117.1.49342 WP_000729117.1.49347 WP_000729117.1.49363 WP_000729117.1.49401 WP_000729117.1.49412 WP_000729117.1.49431 WP_000729117.1.49446 WP_000729117.1.49459 WP_000729117.1.49464 WP_000729117.1.49481 WP_000729117.1.49482 WP_000729117.1.49483 WP_000729117.1.4949 WP_000729117.1.49521 WP_000729117.1.49522 WP_000729117.1.49528 WP_000729117.1.4953 WP_000729117.1.49531 WP_000729117.1.49546 WP_000729117.1.49558 WP_000729117.1.49567 WP_000729117.1.49594 WP_000729117.1.49615 WP_000729117.1.49621 WP_000729117.1.49625 WP_000729117.1.49645 WP_000729117.1.49661 WP_000729117.1.49662 WP_000729117.1.49675 WP_000729117.1.49684 WP_000729117.1.497 WP_000729117.1.49712 WP_000729117.1.49722 WP_000729117.1.49733 WP_000729117.1.49740 WP_000729117.1.49768 WP_000729117.1.49774 WP_000729117.1.49777 WP_000729117.1.49783 WP_000729117.1.49788 WP_000729117.1.49794 WP_000729117.1.49820 WP_000729117.1.49823 WP_000729117.1.4985 WP_000729117.1.49856 WP_000729117.1.49861 WP_000729117.1.49879 WP_000729117.1.49883 WP_000729117.1.49884 WP_000729117.1.49941 WP_000729117.1.49950 WP_000729117.1.49954 WP_000729117.1.49972 WP_000729117.1.49987 WP_000729117.1.50008 WP_000729117.1.5003 WP_000729117.1.50036 WP_000729117.1.50058 WP_000729117.1.50078 WP_000729117.1.50098 WP_000729117.1.50110 WP_000729117.1.50113 WP_000729117.1.50136 WP_000729117.1.50146 WP_000729117.1.5017 WP_000729117.1.50179 WP_000729117.1.50182 WP_000729117.1.50187 WP_000729117.1.50191 WP_000729117.1.50196 WP_000729117.1.50207 WP_000729117.1.50228 WP_000729117.1.50230 WP_000729117.1.50258 WP_000729117.1.50262 WP_000729117.1.50266 WP_000729117.1.50269 WP_000729117.1.50270 WP_000729117.1.50273 WP_000729117.1.50278 WP_000729117.1.50329 WP_000729117.1.50345 WP_000729117.1.50353 WP_000729117.1.50358 WP_000729117.1.50361 WP_000729117.1.50366 WP_000729117.1.5037 WP_000729117.1.50380 WP_000729117.1.50381 WP_000729117.1.5040 WP_000729117.1.5041 WP_000729117.1.50412 WP_000729117.1.50418 WP_000729117.1.50427 WP_000729117.1.50446 WP_000729117.1.50452 WP_000729117.1.5046 WP_000729117.1.50539 WP_000729117.1.50548 WP_000729117.1.50549 WP_000729117.1.5056 WP_000729117.1.50564 WP_000729117.1.50579 WP_000729117.1.50585 WP_000729117.1.50586 WP_000729117.1.506 WP_000729117.1.50608 WP_000729117.1.50616 WP_000729117.1.5064 WP_000729117.1.5067 WP_000729117.1.50690 WP_000729117.1.50700 WP_000729117.1.50715 WP_000729117.1.50717 WP_000729117.1.50725 WP_000729117.1.50728 WP_000729117.1.50762 WP_000729117.1.50887 WP_000729117.1.50925 WP_000729117.1.50936 WP_000729117.1.50939 WP_000729117.1.50947 WP_000729117.1.5095 WP_000729117.1.50957 WP_000729117.1.50969 WP_000729117.1.50986 WP_000729117.1.50988 WP_000729117.1.50990 WP_000729117.1.50993 WP_000729117.1.51013 WP_000729117.1.51027 WP_000729117.1.51042 WP_000729117.1.5106 WP_000729117.1.511 WP_000729117.1.51109 WP_000729117.1.51127 WP_000729117.1.51154 WP_000729117.1.51170 WP_000729117.1.51171 WP_000729117.1.51172 WP_000729117.1.51175 WP_000729117.1.51180 WP_000729117.1.51190 WP_000729117.1.51201 WP_000729117.1.51203 WP_000729117.1.51206 WP_000729117.1.51211 WP_000729117.1.5124 WP_000729117.1.51253 WP_000729117.1.51255 WP_000729117.1.51260 WP_000729117.1.5128 WP_000729117.1.51283 WP_000729117.1.51299 WP_000729117.1.51300 WP_000729117.1.51307 WP_000729117.1.51320 WP_000729117.1.51323 WP_000729117.1.51325 WP_000729117.1.51330 WP_000729117.1.51336 WP_000729117.1.51354 WP_000729117.1.51360 WP_000729117.1.51364 WP_000729117.1.51380 WP_000729117.1.51392 WP_000729117.1.51405 WP_000729117.1.51425 WP_000729117.1.51426 WP_000729117.1.51427 WP_000729117.1.5146 WP_000729117.1.51462 WP_000729117.1.51482 WP_000729117.1.51490 WP_000729117.1.51495 WP_000729117.1.51503 WP_000729117.1.51505 WP_000729117.1.51513 WP_000729117.1.51525 WP_000729117.1.5153 WP_000729117.1.51537 WP_000729117.1.51539 WP_000729117.1.51542 WP_000729117.1.51548 WP_000729117.1.51552 WP_000729117.1.5157 WP_000729117.1.5158 WP_000729117.1.51580 WP_000729117.1.51587 WP_000729117.1.51596 WP_000729117.1.51600 WP_000729117.1.51624 WP_000729117.1.51629 WP_000729117.1.51643 WP_000729117.1.51662 WP_000729117.1.51690 WP_000729117.1.51693 WP_000729117.1.51707 WP_000729117.1.51718 WP_000729117.1.51757 WP_000729117.1.51760 WP_000729117.1.51784 WP_000729117.1.518 WP_000729117.1.51834 WP_000729117.1.51837 WP_000729117.1.51839 WP_000729117.1.51869 WP_000729117.1.51873 WP_000729117.1.51881 WP_000729117.1.51896 WP_000729117.1.51899 WP_000729117.1.51906 WP_000729117.1.51944 WP_000729117.1.51949 WP_000729117.1.51968 WP_000729117.1.51979 WP_000729117.1.51985 WP_000729117.1.51988 WP_000729117.1.5199 WP_000729117.1.51999 WP_000729117.1.52002 WP_000729117.1.52011 WP_000729117.1.52039 WP_000729117.1.52044 WP_000729117.1.52048 WP_000729117.1.52062 WP_000729117.1.52076 WP_000729117.1.52085 WP_000729117.1.52098 WP_000729117.1.52111 WP_000729117.1.52126 WP_000729117.1.52127 WP_000729117.1.52135 WP_000729117.1.52137 WP_000729117.1.5217 WP_000729117.1.52171 WP_000729117.1.52186 WP_000729117.1.52200 WP_000729117.1.52213 WP_000729117.1.52214 WP_000729117.1.52225 WP_000729117.1.52230 WP_000729117.1.52236 WP_000729117.1.52240 WP_000729117.1.52243 WP_000729117.1.52249 WP_000729117.1.52257 WP_000729117.1.52258 WP_000729117.1.5227 WP_000729117.1.52270 WP_000729117.1.52271 WP_000729117.1.52272 WP_000729117.1.52304 WP_000729117.1.52305 WP_000729117.1.52313 WP_000729117.1.52324 WP_000729117.1.52328 WP_000729117.1.52333 WP_000729117.1.52363 WP_000729117.1.52378 WP_000729117.1.5239 WP_000729117.1.52399 WP_000729117.1.52406 WP_000729117.1.52413 WP_000729117.1.52419 WP_000729117.1.52421 WP_000729117.1.52492 WP_000729117.1.52496 WP_000729117.1.52524 WP_000729117.1.52542 WP_000729117.1.52543 WP_000729117.1.52544 WP_000729117.1.52554 WP_000729117.1.52558 WP_000729117.1.52567 WP_000729117.1.52568 WP_000729117.1.52601 WP_000729117.1.52612 WP_000729117.1.52631 WP_000729117.1.5265 WP_000729117.1.52662 WP_000729117.1.52691 WP_000729117.1.52704 WP_000729117.1.52710 WP_000729117.1.52735 WP_000729117.1.52755 WP_000729117.1.52762 WP_000729117.1.52771 WP_000729117.1.52774 WP_000729117.1.52777 WP_000729117.1.52780 WP_000729117.1.52781 WP_000729117.1.52801 WP_000729117.1.52844 WP_000729117.1.52846 WP_000729117.1.5285 WP_000729117.1.52852 WP_000729117.1.52853 WP_000729117.1.52855 WP_000729117.1.52881 WP_000729117.1.52883 WP_000729117.1.52895 WP_000729117.1.52908 WP_000729117.1.5291 WP_000729117.1.52913 WP_000729117.1.52933 WP_000729117.1.52942 WP_000729117.1.52945 WP_000729117.1.52962 WP_000729117.1.52995 WP_000729117.1.52996 WP_000729117.1.53012 WP_000729117.1.53020 WP_000729117.1.53021 WP_000729117.1.53027 WP_000729117.1.53084 WP_000729117.1.53095 WP_000729117.1.53099 WP_000729117.1.5310 WP_000729117.1.53110 WP_000729117.1.53123 WP_000729117.1.53155 WP_000729117.1.53162 WP_000729117.1.53181 WP_000729117.1.53186 WP_000729117.1.532 WP_000729117.1.53211 WP_000729117.1.5322 WP_000729117.1.53223 WP_000729117.1.53238 WP_000729117.1.53242 WP_000729117.1.53244 WP_000729117.1.53251 WP_000729117.1.53252 WP_000729117.1.53262 WP_000729117.1.53270 WP_000729117.1.53277 WP_000729117.1.53308 WP_000729117.1.53327 WP_000729117.1.53356 WP_000729117.1.53360 WP_000729117.1.53364 WP_000729117.1.53377 WP_000729117.1.53401 WP_000729117.1.53410 WP_000729117.1.53415 WP_000729117.1.53419 WP_000729117.1.5342 WP_000729117.1.53431 WP_000729117.1.53482 WP_000729117.1.53505 WP_000729117.1.5351 WP_000729117.1.53535 WP_000729117.1.53537 WP_000729117.1.53545 WP_000729117.1.53556 WP_000729117.1.53557 WP_000729117.1.53574 WP_000729117.1.53582 WP_000729117.1.53587 WP_000729117.1.53589 WP_000729117.1.53590 WP_000729117.1.53592 WP_000729117.1.53594 WP_000729117.1.5362 WP_000729117.1.53642 WP_000729117.1.53649 WP_000729117.1.53687 WP_000729117.1.53690 WP_000729117.1.53693 WP_000729117.1.53706 WP_000729117.1.53769 WP_000729117.1.53809 WP_000729117.1.53810 WP_000729117.1.53811 WP_000729117.1.53841 WP_000729117.1.53863 WP_000729117.1.53866 WP_000729117.1.53884 WP_000729117.1.5391 WP_000729117.1.5393 WP_000729117.1.53940 WP_000729117.1.5395 WP_000729117.1.53966 WP_000729117.1.53968 WP_000729117.1.53972 WP_000729117.1.53978 WP_000729117.1.53991 WP_000729117.1.53994 WP_000729117.1.54002 WP_000729117.1.54013 WP_000729117.1.54023 WP_000729117.1.54024 WP_000729117.1.54028 WP_000729117.1.54032 WP_000729117.1.54051 WP_000729117.1.54072 WP_000729117.1.54091 WP_000729117.1.54095 WP_000729117.1.54102 WP_000729117.1.54104 WP_000729117.1.54169 WP_000729117.1.54185 WP_000729117.1.54188 WP_000729117.1.54202 WP_000729117.1.54208 WP_000729117.1.54213 WP_000729117.1.54263 WP_000729117.1.54307 WP_000729117.1.54313 WP_000729117.1.54317 WP_000729117.1.54328 WP_000729117.1.54329 WP_000729117.1.5433 WP_000729117.1.5434 WP_000729117.1.54344 WP_000729117.1.54359 WP_000729117.1.54388 WP_000729117.1.54394 WP_000729117.1.5440 WP_000729117.1.5441 WP_000729117.1.54411 WP_000729117.1.54417 WP_000729117.1.54418 WP_000729117.1.54429 WP_000729117.1.54439 WP_000729117.1.54454 WP_000729117.1.54463 WP_000729117.1.54476 WP_000729117.1.54507 WP_000729117.1.54534 WP_000729117.1.54546 WP_000729117.1.54590 WP_000729117.1.54591 WP_000729117.1.5460 WP_000729117.1.54601 WP_000729117.1.54602 WP_000729117.1.54605 WP_000729117.1.54614 WP_000729117.1.54617 WP_000729117.1.54620 WP_000729117.1.54625 WP_000729117.1.54638 WP_000729117.1.54641 WP_000729117.1.54643 WP_000729117.1.5467 WP_000729117.1.54688 WP_000729117.1.54695 WP_000729117.1.5470 WP_000729117.1.54708 WP_000729117.1.54725 WP_000729117.1.54729 WP_000729117.1.54754 WP_000729117.1.54755 WP_000729117.1.54760 WP_000729117.1.54769 WP_000729117.1.5479 WP_000729117.1.54798 WP_000729117.1.54817 WP_000729117.1.54829 WP_000729117.1.5486 WP_000729117.1.54875 WP_000729117.1.54883 WP_000729117.1.54918 WP_000729117.1.54921 WP_000729117.1.54927 WP_000729117.1.54940 WP_000729117.1.54941 WP_000729117.1.54946 WP_000729117.1.54972 WP_000729117.1.54981 WP_000729117.1.54989 WP_000729117.1.54991 WP_000729117.1.54993 WP_000729117.1.55003 WP_000729117.1.55005 WP_000729117.1.55009 WP_000729117.1.55041 WP_000729117.1.55070 WP_000729117.1.55112 WP_000729117.1.55115 WP_000729117.1.55123 WP_000729117.1.55134 WP_000729117.1.55144 WP_000729117.1.55149 WP_000729117.1.55151 WP_000729117.1.55177 WP_000729117.1.55179 WP_000729117.1.55185 WP_000729117.1.55197 WP_000729117.1.5520 WP_000729117.1.55203 WP_000729117.1.55218 WP_000729117.1.55222 WP_000729117.1.55226 WP_000729117.1.55273 WP_000729117.1.55275 WP_000729117.1.55286 WP_000729117.1.55291 WP_000729117.1.55338 WP_000729117.1.55342 WP_000729117.1.55357 WP_000729117.1.55359 WP_000729117.1.55374 WP_000729117.1.55381 WP_000729117.1.55417 WP_000729117.1.55424 WP_000729117.1.5546 WP_000729117.1.55466 WP_000729117.1.55472 WP_000729117.1.55482 WP_000729117.1.55483 WP_000729117.1.55489 WP_000729117.1.55492 WP_000729117.1.55507 WP_000729117.1.55529 WP_000729117.1.55550 WP_000729117.1.55551 WP_000729117.1.55552 WP_000729117.1.55556 WP_000729117.1.55560 WP_000729117.1.55563 WP_000729117.1.55571 WP_000729117.1.55574 WP_000729117.1.55581 WP_000729117.1.55597 WP_000729117.1.55608 WP_000729117.1.5561 WP_000729117.1.55629 WP_000729117.1.5566 WP_000729117.1.55676 WP_000729117.1.5570 WP_000729117.1.55709 WP_000729117.1.55720 WP_000729117.1.55727 WP_000729117.1.55730 WP_000729117.1.55731 WP_000729117.1.55744 WP_000729117.1.55757 WP_000729117.1.55787 WP_000729117.1.55791 WP_000729117.1.55808 WP_000729117.1.55820 WP_000729117.1.55825 WP_000729117.1.55838 WP_000729117.1.55844 WP_000729117.1.55868 WP_000729117.1.55870 WP_000729117.1.55892 WP_000729117.1.55896 WP_000729117.1.55897 WP_000729117.1.55936 WP_000729117.1.55979 WP_000729117.1.55981 WP_000729117.1.55988 WP_000729117.1.55990 WP_000729117.1.56033 WP_000729117.1.56040 WP_000729117.1.56047 WP_000729117.1.56072 WP_000729117.1.56101 WP_000729117.1.56122 WP_000729117.1.56139 WP_000729117.1.5614 WP_000729117.1.56142 WP_000729117.1.56149 WP_000729117.1.56151 WP_000729117.1.5616 WP_000729117.1.56169 WP_000729117.1.56177 WP_000729117.1.56193 WP_000729117.1.56197 WP_000729117.1.562 WP_000729117.1.56216 WP_000729117.1.56231 WP_000729117.1.56278 WP_000729117.1.56285 WP_000729117.1.56293 WP_000729117.1.56302 WP_000729117.1.5632 WP_000729117.1.56338 WP_000729117.1.56345 WP_000729117.1.56358 WP_000729117.1.56371 WP_000729117.1.56388 WP_000729117.1.5639 WP_000729117.1.56390 WP_000729117.1.56392 WP_000729117.1.56402 WP_000729117.1.56439 WP_000729117.1.56446 WP_000729117.1.56457 WP_000729117.1.5646 WP_000729117.1.56469 WP_000729117.1.56481 WP_000729117.1.56489 WP_000729117.1.5649 WP_000729117.1.56491 WP_000729117.1.56501 WP_000729117.1.56502 WP_000729117.1.56513 WP_000729117.1.56523 WP_000729117.1.56528 WP_000729117.1.56543 WP_000729117.1.56554 WP_000729117.1.56571 WP_000729117.1.56573 WP_000729117.1.56586 WP_000729117.1.56650 WP_000729117.1.56662 WP_000729117.1.56665 WP_000729117.1.56680 WP_000729117.1.56689 WP_000729117.1.5670 WP_000729117.1.56704 WP_000729117.1.56713 WP_000729117.1.56714 WP_000729117.1.56721 WP_000729117.1.56776 WP_000729117.1.56777 WP_000729117.1.56786 WP_000729117.1.56787 WP_000729117.1.56789 WP_000729117.1.56799 WP_000729117.1.56821 WP_000729117.1.56830 WP_000729117.1.56835 WP_000729117.1.56846 WP_000729117.1.56871 WP_000729117.1.56908 WP_000729117.1.56933 WP_000729117.1.56936 WP_000729117.1.56937 WP_000729117.1.56941 WP_000729117.1.56951 WP_000729117.1.56978 WP_000729117.1.56980 WP_000729117.1.56992 WP_000729117.1.57011 WP_000729117.1.57032 WP_000729117.1.57045 WP_000729117.1.57051 WP_000729117.1.57068 WP_000729117.1.57071 WP_000729117.1.57072 WP_000729117.1.57079 WP_000729117.1.57086 WP_000729117.1.57100 WP_000729117.1.57124 WP_000729117.1.57150 WP_000729117.1.57159 WP_000729117.1.57180 WP_000729117.1.57181 WP_000729117.1.57182 WP_000729117.1.57197 WP_000729117.1.57202 WP_000729117.1.57213 WP_000729117.1.57216 WP_000729117.1.57222 WP_000729117.1.57254 WP_000729117.1.57266 WP_000729117.1.57269 WP_000729117.1.57278 WP_000729117.1.57281 WP_000729117.1.57319 WP_000729117.1.57348 WP_000729117.1.57349 WP_000729117.1.57395 WP_000729117.1.57401 WP_000729117.1.57403 WP_000729117.1.57410 WP_000729117.1.5742 WP_000729117.1.57432 WP_000729117.1.57438 WP_000729117.1.57451 WP_000729117.1.57453 WP_000729117.1.57466 WP_000729117.1.57487 WP_000729117.1.57492 WP_000729117.1.57538 WP_000729117.1.57539 WP_000729117.1.5755 WP_000729117.1.57550 WP_000729117.1.57558 WP_000729117.1.57574 WP_000729117.1.57588 WP_000729117.1.57608 WP_000729117.1.57610 WP_000729117.1.57628 WP_000729117.1.57629 WP_000729117.1.57634 WP_000729117.1.57638 WP_000729117.1.5764 WP_000729117.1.57646 WP_000729117.1.57659 WP_000729117.1.57663 WP_000729117.1.57669 WP_000729117.1.57719 WP_000729117.1.57738 WP_000729117.1.57812 WP_000729117.1.57832 WP_000729117.1.57836 WP_000729117.1.57846 WP_000729117.1.57851 WP_000729117.1.57854 WP_000729117.1.5786 WP_000729117.1.5787 WP_000729117.1.57898 WP_000729117.1.57903 WP_000729117.1.57904 WP_000729117.1.57920 WP_000729117.1.57951 WP_000729117.1.57975 WP_000729117.1.57982 WP_000729117.1.57983 WP_000729117.1.57994 WP_000729117.1.58001 WP_000729117.1.58009 WP_000729117.1.58022 WP_000729117.1.58038 WP_000729117.1.58045 WP_000729117.1.58048 WP_000729117.1.58057 WP_000729117.1.58060 WP_000729117.1.58080 WP_000729117.1.58092 WP_000729117.1.58094 WP_000729117.1.58097 WP_000729117.1.58098 WP_000729117.1.5810 WP_000729117.1.58107 WP_000729117.1.5812 WP_000729117.1.58128 WP_000729117.1.58136 WP_000729117.1.58143 WP_000729117.1.58146 WP_000729117.1.58163 WP_000729117.1.58169 WP_000729117.1.58172 WP_000729117.1.58206 WP_000729117.1.58226 WP_000729117.1.58232 WP_000729117.1.58233 WP_000729117.1.58238 WP_000729117.1.58244 WP_000729117.1.58248 WP_000729117.1.58267 WP_000729117.1.58336 WP_000729117.1.58340 WP_000729117.1.58345 WP_000729117.1.58368 WP_000729117.1.58371 WP_000729117.1.58384 WP_000729117.1.584 WP_000729117.1.58401 WP_000729117.1.58408 WP_000729117.1.58414 WP_000729117.1.5842 WP_000729117.1.58420 WP_000729117.1.58423 WP_000729117.1.58424 WP_000729117.1.58429 WP_000729117.1.58440 WP_000729117.1.58444 WP_000729117.1.58445 WP_000729117.1.58449 WP_000729117.1.58459 WP_000729117.1.58475 WP_000729117.1.58484 WP_000729117.1.58493 WP_000729117.1.58496 WP_000729117.1.58507 WP_000729117.1.58514 WP_000729117.1.5852 WP_000729117.1.58528 WP_000729117.1.58547 WP_000729117.1.58552 WP_000729117.1.58560 WP_000729117.1.58572 WP_000729117.1.58582 WP_000729117.1.58609 WP_000729117.1.58617 WP_000729117.1.58622 WP_000729117.1.58657 WP_000729117.1.58680 WP_000729117.1.58692 WP_000729117.1.58705 WP_000729117.1.58707 WP_000729117.1.58723 WP_000729117.1.58737 WP_000729117.1.58837 WP_000729117.1.58867 WP_000729117.1.58870 WP_000729117.1.58901 WP_000729117.1.58940 WP_000729117.1.58942 WP_000729117.1.58958 WP_000729117.1.58976 WP_000729117.1.58977 WP_000729117.1.58983 WP_000729117.1.58999 WP_000729117.1.59024 WP_000729117.1.59026 WP_000729117.1.59035 WP_000729117.1.59038 WP_000729117.1.59055 WP_000729117.1.5906 WP_000729117.1.59060 WP_000729117.1.59073 WP_000729117.1.59083 WP_000729117.1.59119 WP_000729117.1.59165 WP_000729117.1.59174 WP_000729117.1.59190 WP_000729117.1.59199 WP_000729117.1.59218 WP_000729117.1.59263 WP_000729117.1.5927 WP_000729117.1.59280 WP_000729117.1.59291 WP_000729117.1.59292 WP_000729117.1.59293 WP_000729117.1.59302 WP_000729117.1.59306 WP_000729117.1.59359 WP_000729117.1.59374 WP_000729117.1.59395 WP_000729117.1.59396 WP_000729117.1.59407 WP_000729117.1.59413 WP_000729117.1.5942 WP_000729117.1.59423 WP_000729117.1.59425 WP_000729117.1.59426 WP_000729117.1.59434 WP_000729117.1.59470 WP_000729117.1.59483 WP_000729117.1.59491 WP_000729117.1.59513 WP_000729117.1.59533 WP_000729117.1.59553 WP_000729117.1.59572 WP_000729117.1.59577 WP_000729117.1.59579 WP_000729117.1.59611 WP_000729117.1.59613 WP_000729117.1.59615 WP_000729117.1.59621 WP_000729117.1.5963 WP_000729117.1.59638 WP_000729117.1.5965 WP_000729117.1.59660 WP_000729117.1.59679 WP_000729117.1.59689 WP_000729117.1.59699 WP_000729117.1.597 WP_000729117.1.59714 WP_000729117.1.59717 WP_000729117.1.59730 WP_000729117.1.59733 WP_000729117.1.59737 WP_000729117.1.59745 WP_000729117.1.59748 WP_000729117.1.59756 WP_000729117.1.59781 WP_000729117.1.59782 WP_000729117.1.59788 WP_000729117.1.59793 WP_000729117.1.59815 WP_000729117.1.59823 WP_000729117.1.59836 WP_000729117.1.59838 WP_000729117.1.59853 WP_000729117.1.59855 WP_000729117.1.59858 WP_000729117.1.59877 WP_000729117.1.59894 WP_000729117.1.5990 WP_000729117.1.59900 WP_000729117.1.59905 WP_000729117.1.59912 WP_000729117.1.59914 WP_000729117.1.59931 WP_000729117.1.59959 WP_000729117.1.59970 WP_000729117.1.59981 WP_000729117.1.59989 WP_000729117.1.60005 WP_000729117.1.6002 WP_000729117.1.60023 WP_000729117.1.60042 WP_000729117.1.60043 WP_000729117.1.60048 WP_000729117.1.60067 WP_000729117.1.60070 WP_000729117.1.60095 WP_000729117.1.60096 WP_000729117.1.60110 WP_000729117.1.60117 WP_000729117.1.6013 WP_000729117.1.60133 WP_000729117.1.60151 WP_000729117.1.60186 WP_000729117.1.6022 WP_000729117.1.60225 WP_000729117.1.60228 WP_000729117.1.60235 WP_000729117.1.60246 WP_000729117.1.60304 WP_000729117.1.60325 WP_000729117.1.60337 WP_000729117.1.60342 WP_000729117.1.60343 WP_000729117.1.60350 WP_000729117.1.60373 WP_000729117.1.60374 WP_000729117.1.60387 WP_000729117.1.60411 WP_000729117.1.60436 WP_000729117.1.60443 WP_000729117.1.60453 WP_000729117.1.60461 WP_000729117.1.60491 WP_000729117.1.60498 WP_000729117.1.60505 WP_000729117.1.60544 WP_000729117.1.60550 WP_000729117.1.60555 WP_000729117.1.60559 WP_000729117.1.60567 WP_000729117.1.60570 WP_000729117.1.6059 WP_000729117.1.60591 WP_000729117.1.60599 WP_000729117.1.60606 WP_000729117.1.6061 WP_000729117.1.60613 WP_000729117.1.60614 WP_000729117.1.60630 WP_000729117.1.6064 WP_000729117.1.60644 WP_000729117.1.60647 WP_000729117.1.60654 WP_000729117.1.6066 WP_000729117.1.60671 WP_000729117.1.6068 WP_000729117.1.60684 WP_000729117.1.60698 WP_000729117.1.60717 WP_000729117.1.60732 WP_000729117.1.60744 WP_000729117.1.60761 WP_000729117.1.60764 WP_000729117.1.60771 WP_000729117.1.60816 WP_000729117.1.60826 WP_000729117.1.60835 WP_000729117.1.60847 WP_000729117.1.60872 WP_000729117.1.60895 WP_000729117.1.60901 WP_000729117.1.60921 WP_000729117.1.60925 WP_000729117.1.60927 WP_000729117.1.60935 WP_000729117.1.6094 WP_000729117.1.60974 WP_000729117.1.61005 WP_000729117.1.61006 WP_000729117.1.61008 WP_000729117.1.61035 WP_000729117.1.61039 WP_000729117.1.61046 WP_000729117.1.61058 WP_000729117.1.6106 WP_000729117.1.61096 WP_000729117.1.61097 WP_000729117.1.61099 WP_000729117.1.6110 WP_000729117.1.61102 WP_000729117.1.61108 WP_000729117.1.61112 WP_000729117.1.61121 WP_000729117.1.61132 WP_000729117.1.61148 WP_000729117.1.61170 WP_000729117.1.61174 WP_000729117.1.61181 WP_000729117.1.61183 WP_000729117.1.61186 WP_000729117.1.61223 WP_000729117.1.61225 WP_000729117.1.61241 WP_000729117.1.61245 WP_000729117.1.61253 WP_000729117.1.61268 WP_000729117.1.61284 WP_000729117.1.61292 WP_000729117.1.613 WP_000729117.1.61360 WP_000729117.1.61362 WP_000729117.1.61364 WP_000729117.1.61373 WP_000729117.1.6138 WP_000729117.1.61398 WP_000729117.1.61442 WP_000729117.1.61445 WP_000729117.1.61480 WP_000729117.1.61496 WP_000729117.1.61505 WP_000729117.1.61512 WP_000729117.1.61517 WP_000729117.1.61551 WP_000729117.1.61608 WP_000729117.1.61612 WP_000729117.1.61617 WP_000729117.1.61623 WP_000729117.1.61636 WP_000729117.1.61643 WP_000729117.1.61663 WP_000729117.1.61703 WP_000729117.1.61718 WP_000729117.1.61739 WP_000729117.1.61758 WP_000729117.1.61770 WP_000729117.1.61772 WP_000729117.1.61779 WP_000729117.1.61789 WP_000729117.1.618 WP_000729117.1.61806 WP_000729117.1.61822 WP_000729117.1.61835 WP_000729117.1.61853 WP_000729117.1.61858 WP_000729117.1.61874 WP_000729117.1.61893 WP_000729117.1.61926 WP_000729117.1.61939 WP_000729117.1.61948 WP_000729117.1.61949 WP_000729117.1.61955 WP_000729117.1.61957 WP_000729117.1.61966 WP_000729117.1.61985 WP_000729117.1.62038 WP_000729117.1.62041 WP_000729117.1.62043 WP_000729117.1.62091 WP_000729117.1.62099 WP_000729117.1.62102 WP_000729117.1.6212 WP_000729117.1.62135 WP_000729117.1.62157 WP_000729117.1.62182 WP_000729117.1.62207 WP_000729117.1.62236 WP_000729117.1.62262 WP_000729117.1.62264 WP_000729117.1.62266 WP_000729117.1.62282 WP_000729117.1.62290 WP_000729117.1.62296 WP_000729117.1.62303 WP_000729117.1.62322 WP_000729117.1.62337 WP_000729117.1.62348 WP_000729117.1.62358 WP_000729117.1.62424 WP_000729117.1.62447 WP_000729117.1.6245 WP_000729117.1.62454 WP_000729117.1.62460 WP_000729117.1.62480 WP_000729117.1.62481 WP_000729117.1.62503 WP_000729117.1.62507 WP_000729117.1.62513 WP_000729117.1.62529 WP_000729117.1.62541 WP_000729117.1.62555 WP_000729117.1.62586 WP_000729117.1.6261 WP_000729117.1.62612 WP_000729117.1.62631 WP_000729117.1.62642 WP_000729117.1.62646 WP_000729117.1.62668 WP_000729117.1.62675 WP_000729117.1.62681 WP_000729117.1.62714 WP_000729117.1.62735 WP_000729117.1.62750 WP_000729117.1.62762 WP_000729117.1.62769 WP_000729117.1.62780 WP_000729117.1.62784 WP_000729117.1.62787 WP_000729117.1.62788 WP_000729117.1.62802 WP_000729117.1.62812 WP_000729117.1.62818 WP_000729117.1.62819 WP_000729117.1.6282 WP_000729117.1.62840 WP_000729117.1.62843 WP_000729117.1.62850 WP_000729117.1.62851 WP_000729117.1.62866 WP_000729117.1.62885 WP_000729117.1.62888 WP_000729117.1.62914 WP_000729117.1.62919 WP_000729117.1.6293 WP_000729117.1.62931 WP_000729117.1.62951 WP_000729117.1.62959 WP_000729117.1.62973 WP_000729117.1.62989 WP_000729117.1.6299 WP_000729117.1.62992 WP_000729117.1.63023 WP_000729117.1.6307 WP_000729117.1.63078 WP_000729117.1.63113 WP_000729117.1.63167 WP_000729117.1.63177 WP_000729117.1.63189 WP_000729117.1.6323 WP_000729117.1.63246 WP_000729117.1.63271 WP_000729117.1.63285 WP_000729117.1.63287 WP_000729117.1.63305 WP_000729117.1.6331 WP_000729117.1.63310 WP_000729117.1.6334 WP_000729117.1.63350 WP_000729117.1.6337 WP_000729117.1.63370 WP_000729117.1.63374 WP_000729117.1.63393 WP_000729117.1.63419 WP_000729117.1.63433 WP_000729117.1.63437 WP_000729117.1.63445 WP_000729117.1.63465 WP_000729117.1.63466 WP_000729117.1.63467 WP_000729117.1.63470 WP_000729117.1.63478 WP_000729117.1.6348 WP_000729117.1.63484 WP_000729117.1.63487 WP_000729117.1.63491 WP_000729117.1.63496 WP_000729117.1.63536 WP_000729117.1.63554 WP_000729117.1.63556 WP_000729117.1.63563 WP_000729117.1.63576 WP_000729117.1.63586 WP_000729117.1.63602 WP_000729117.1.63604 WP_000729117.1.63608 WP_000729117.1.63612 WP_000729117.1.63615 WP_000729117.1.6364 WP_000729117.1.63666 WP_000729117.1.63679 WP_000729117.1.63683 WP_000729117.1.63703 WP_000729117.1.63721 WP_000729117.1.63746 WP_000729117.1.63800 WP_000729117.1.63810 WP_000729117.1.63814 WP_000729117.1.63821 WP_000729117.1.63856 WP_000729117.1.63871 WP_000729117.1.63872 WP_000729117.1.63944 WP_000729117.1.63957 WP_000729117.1.63964 WP_000729117.1.63969 WP_000729117.1.63990 WP_000729117.1.64008 WP_000729117.1.64014 WP_000729117.1.64030 WP_000729117.1.64045 WP_000729117.1.64050 WP_000729117.1.64053 WP_000729117.1.64074 WP_000729117.1.64080 WP_000729117.1.64086 WP_000729117.1.64138 WP_000729117.1.64150 WP_000729117.1.64153 WP_000729117.1.6416 WP_000729117.1.64161 WP_000729117.1.64165 WP_000729117.1.64175 WP_000729117.1.64180 WP_000729117.1.64190 WP_000729117.1.64193 WP_000729117.1.64280 WP_000729117.1.64286 WP_000729117.1.643 WP_000729117.1.6431 WP_000729117.1.64312 WP_000729117.1.64321 WP_000729117.1.64330 WP_000729117.1.64337 WP_000729117.1.64353 WP_000729117.1.64355 WP_000729117.1.64356 WP_000729117.1.64371 WP_000729117.1.64380 WP_000729117.1.64391 WP_000729117.1.6441 WP_000729117.1.64417 WP_000729117.1.64437 WP_000729117.1.64438 WP_000729117.1.64448 WP_000729117.1.6445 WP_000729117.1.64458 WP_000729117.1.6446 WP_000729117.1.64519 WP_000729117.1.64520 WP_000729117.1.64528 WP_000729117.1.64540 WP_000729117.1.64547 WP_000729117.1.64563 WP_000729117.1.64634 WP_000729117.1.64657 WP_000729117.1.64670 WP_000729117.1.6469 WP_000729117.1.64693 WP_000729117.1.64695 WP_000729117.1.647 WP_000729117.1.64707 WP_000729117.1.64712 WP_000729117.1.64746 WP_000729117.1.64749 WP_000729117.1.64784 WP_000729117.1.64789 WP_000729117.1.64793 WP_000729117.1.64821 WP_000729117.1.64840 WP_000729117.1.64866 WP_000729117.1.64875 WP_000729117.1.64881 WP_000729117.1.64895 WP_000729117.1.64901 WP_000729117.1.64912 WP_000729117.1.64926 WP_000729117.1.64930 WP_000729117.1.64939 WP_000729117.1.64946 WP_000729117.1.64970 WP_000729117.1.6499 WP_000729117.1.64990 WP_000729117.1.6500 WP_000729117.1.65023 WP_000729117.1.65035 WP_000729117.1.65040 WP_000729117.1.65056 WP_000729117.1.65061 WP_000729117.1.65084 WP_000729117.1.65097 WP_000729117.1.651 WP_000729117.1.6511 WP_000729117.1.65110 WP_000729117.1.65114 WP_000729117.1.65116 WP_000729117.1.65118 WP_000729117.1.65122 WP_000729117.1.65135 WP_000729117.1.65151 WP_000729117.1.65155 WP_000729117.1.6516 WP_000729117.1.65179 WP_000729117.1.65192 WP_000729117.1.65206 WP_000729117.1.65240 WP_000729117.1.65256 WP_000729117.1.6527 WP_000729117.1.65271 WP_000729117.1.65286 WP_000729117.1.65296 WP_000729117.1.65305 WP_000729117.1.65306 WP_000729117.1.65353 WP_000729117.1.65355 WP_000729117.1.65364 WP_000729117.1.65366 WP_000729117.1.6537 WP_000729117.1.65370 WP_000729117.1.65372 WP_000729117.1.654 WP_000729117.1.65405 WP_000729117.1.65408 WP_000729117.1.65413 WP_000729117.1.65415 WP_000729117.1.65456 WP_000729117.1.65484 WP_000729117.1.65493 WP_000729117.1.6553 WP_000729117.1.65531 WP_000729117.1.65546 WP_000729117.1.65571 WP_000729117.1.65581 WP_000729117.1.65596 WP_000729117.1.65606 WP_000729117.1.6563 WP_000729117.1.65662 WP_000729117.1.65667 WP_000729117.1.65672 WP_000729117.1.65677 WP_000729117.1.65708 WP_000729117.1.65714 WP_000729117.1.65749 WP_000729117.1.65762 WP_000729117.1.6587 WP_000729117.1.65875 WP_000729117.1.65898 WP_000729117.1.65912 WP_000729117.1.65954 WP_000729117.1.65957 WP_000729117.1.65962 WP_000729117.1.65963 WP_000729117.1.65976 WP_000729117.1.65978 WP_000729117.1.65988 WP_000729117.1.6599 WP_000729117.1.65991 WP_000729117.1.66001 WP_000729117.1.66007 WP_000729117.1.66016 WP_000729117.1.66017 WP_000729117.1.66022 WP_000729117.1.66033 WP_000729117.1.6604 WP_000729117.1.66044 WP_000729117.1.66050 WP_000729117.1.66059 WP_000729117.1.66071 WP_000729117.1.66100 WP_000729117.1.66102 WP_000729117.1.66105 WP_000729117.1.66127 WP_000729117.1.66161 WP_000729117.1.6618 WP_000729117.1.66181 WP_000729117.1.66187 WP_000729117.1.66197 WP_000729117.1.6622 WP_000729117.1.66251 WP_000729117.1.66255 WP_000729117.1.66264 WP_000729117.1.66280 WP_000729117.1.66288 WP_000729117.1.66290 WP_000729117.1.66295 WP_000729117.1.66327 WP_000729117.1.66335 WP_000729117.1.6635 WP_000729117.1.66376 WP_000729117.1.66392 WP_000729117.1.66395 WP_000729117.1.66412 WP_000729117.1.66421 WP_000729117.1.66432 WP_000729117.1.66448 WP_000729117.1.6645 WP_000729117.1.66501 WP_000729117.1.66511 WP_000729117.1.66523 WP_000729117.1.66531 WP_000729117.1.66550 WP_000729117.1.66559 WP_000729117.1.66566 WP_000729117.1.66579 WP_000729117.1.66624 WP_000729117.1.66644 WP_000729117.1.6665 WP_000729117.1.66667 WP_000729117.1.66668 WP_000729117.1.66700 WP_000729117.1.66706 WP_000729117.1.66708 WP_000729117.1.66719 WP_000729117.1.66727 WP_000729117.1.66751 WP_000729117.1.66758 WP_000729117.1.6676 WP_000729117.1.66783 WP_000729117.1.66791 WP_000729117.1.66794 WP_000729117.1.66795 WP_000729117.1.66796 WP_000729117.1.66849 WP_000729117.1.66873 WP_000729117.1.66922 WP_000729117.1.66926 WP_000729117.1.66933 WP_000729117.1.66948 WP_000729117.1.66975 WP_000729117.1.66978 WP_000729117.1.6698 WP_000729117.1.66984 WP_000729117.1.6701 WP_000729117.1.67018 WP_000729117.1.67021 WP_000729117.1.67022 WP_000729117.1.67026 WP_000729117.1.67029 WP_000729117.1.67035 WP_000729117.1.67047 WP_000729117.1.67055 WP_000729117.1.6706 WP_000729117.1.67073 WP_000729117.1.67102 WP_000729117.1.67116 WP_000729117.1.67120 WP_000729117.1.67132 WP_000729117.1.67149 WP_000729117.1.67153 WP_000729117.1.67158 WP_000729117.1.67164 WP_000729117.1.67174 WP_000729117.1.67193 WP_000729117.1.67194 WP_000729117.1.67200 WP_000729117.1.67209 WP_000729117.1.67210 WP_000729117.1.67214 WP_000729117.1.6723 WP_000729117.1.67258 WP_000729117.1.67272 WP_000729117.1.67278 WP_000729117.1.67284 WP_000729117.1.67293 WP_000729117.1.6735 WP_000729117.1.67373 WP_000729117.1.67383 WP_000729117.1.67415 WP_000729117.1.67427 WP_000729117.1.67446 WP_000729117.1.67451 WP_000729117.1.67454 WP_000729117.1.67462 WP_000729117.1.67464 WP_000729117.1.67467 WP_000729117.1.67468 WP_000729117.1.67495 WP_000729117.1.67522 WP_000729117.1.67533 WP_000729117.1.67549 WP_000729117.1.67553 WP_000729117.1.67581 WP_000729117.1.67590 WP_000729117.1.67606 WP_000729117.1.67660 WP_000729117.1.67663 WP_000729117.1.67669 WP_000729117.1.67676 WP_000729117.1.67681 WP_000729117.1.67685 WP_000729117.1.6769 WP_000729117.1.67690 WP_000729117.1.67701 WP_000729117.1.67704 WP_000729117.1.67724 WP_000729117.1.67726 WP_000729117.1.67732 WP_000729117.1.67737 WP_000729117.1.67758 WP_000729117.1.67760 WP_000729117.1.67775 WP_000729117.1.67780 WP_000729117.1.67786 WP_000729117.1.67787 WP_000729117.1.678 WP_000729117.1.67802 WP_000729117.1.67810 WP_000729117.1.67841 WP_000729117.1.67861 WP_000729117.1.67894 WP_000729117.1.67901 WP_000729117.1.6793 WP_000729117.1.67938 WP_000729117.1.67971 WP_000729117.1.67975 WP_000729117.1.67984 WP_000729117.1.67990 WP_000729117.1.67992 WP_000729117.1.67999 WP_000729117.1.68008 WP_000729117.1.68011 WP_000729117.1.68012 WP_000729117.1.6802 WP_000729117.1.68025 WP_000729117.1.6803 WP_000729117.1.68039 WP_000729117.1.68052 WP_000729117.1.68053 WP_000729117.1.68058 WP_000729117.1.68059 WP_000729117.1.68063 WP_000729117.1.68067 WP_000729117.1.68069 WP_000729117.1.68070 WP_000729117.1.68071 WP_000729117.1.68079 WP_000729117.1.68096 WP_000729117.1.6810 WP_000729117.1.68108 WP_000729117.1.68126 WP_000729117.1.68138 WP_000729117.1.6814 WP_000729117.1.68145 WP_000729117.1.68157 WP_000729117.1.68170 WP_000729117.1.68175 WP_000729117.1.68177 WP_000729117.1.682 WP_000729117.1.68200 WP_000729117.1.68215 WP_000729117.1.68231 WP_000729117.1.68241 WP_000729117.1.68255 WP_000729117.1.68271 WP_000729117.1.68281 WP_000729117.1.68283 WP_000729117.1.68292 WP_000729117.1.68300 WP_000729117.1.68336 WP_000729117.1.68341 WP_000729117.1.68347 WP_000729117.1.68362 WP_000729117.1.68369 WP_000729117.1.68372 WP_000729117.1.68395 WP_000729117.1.68396 WP_000729117.1.68411 WP_000729117.1.68441 WP_000729117.1.68442 WP_000729117.1.68482 WP_000729117.1.68490 WP_000729117.1.68493 WP_000729117.1.68523 WP_000729117.1.68524 WP_000729117.1.68534 WP_000729117.1.68566 WP_000729117.1.68572 WP_000729117.1.68584 WP_000729117.1.6859 WP_000729117.1.68598 WP_000729117.1.6860 WP_000729117.1.68609 WP_000729117.1.68630 WP_000729117.1.68632 WP_000729117.1.68635 WP_000729117.1.68673 WP_000729117.1.68678 WP_000729117.1.68679 WP_000729117.1.68695 WP_000729117.1.68697 WP_000729117.1.68711 WP_000729117.1.68731 WP_000729117.1.68735 WP_000729117.1.68750 WP_000729117.1.68751 WP_000729117.1.68752 WP_000729117.1.6877 WP_000729117.1.68793 WP_000729117.1.68795 WP_000729117.1.68797 WP_000729117.1.6880 WP_000729117.1.68801 WP_000729117.1.68847 WP_000729117.1.68865 WP_000729117.1.6887 WP_000729117.1.68873 WP_000729117.1.68877 WP_000729117.1.68880 WP_000729117.1.68911 WP_000729117.1.68915 WP_000729117.1.68924 WP_000729117.1.68936 WP_000729117.1.68942 WP_000729117.1.68952 WP_000729117.1.68956 WP_000729117.1.68961 WP_000729117.1.6897 WP_000729117.1.68989 WP_000729117.1.68995 WP_000729117.1.69033 WP_000729117.1.69039 WP_000729117.1.69054 WP_000729117.1.69098 WP_000729117.1.69126 WP_000729117.1.69127 WP_000729117.1.69158 WP_000729117.1.6916 WP_000729117.1.69160 WP_000729117.1.6919 WP_000729117.1.69192 WP_000729117.1.6921 WP_000729117.1.69221 WP_000729117.1.6923 WP_000729117.1.69261 WP_000729117.1.6929 WP_000729117.1.69305 WP_000729117.1.69327 WP_000729117.1.69341 WP_000729117.1.69350 WP_000729117.1.69351 WP_000729117.1.69382 WP_000729117.1.69390 WP_000729117.1.694 WP_000729117.1.69404 WP_000729117.1.69438 WP_000729117.1.69441 WP_000729117.1.6945 WP_000729117.1.69450 WP_000729117.1.69472 WP_000729117.1.69473 WP_000729117.1.69502 WP_000729117.1.69506 WP_000729117.1.69537 WP_000729117.1.69551 WP_000729117.1.69569 WP_000729117.1.69583 WP_000729117.1.69589 WP_000729117.1.69593 WP_000729117.1.69596 WP_000729117.1.69605 WP_000729117.1.69643 WP_000729117.1.69646 WP_000729117.1.69655 WP_000729117.1.69689 WP_000729117.1.69716 WP_000729117.1.69730 WP_000729117.1.69735 WP_000729117.1.69780 WP_000729117.1.69786 WP_000729117.1.69803 WP_000729117.1.69810 WP_000729117.1.69818 WP_000729117.1.69831 WP_000729117.1.69832 WP_000729117.1.69868 WP_000729117.1.69872 WP_000729117.1.69887 WP_000729117.1.69896 WP_000729117.1.6993 WP_000729117.1.69963 WP_000729117.1.69972 WP_000729117.1.69979 WP_000729117.1.7001 WP_000729117.1.70041 WP_000729117.1.70063 WP_000729117.1.70081 WP_000729117.1.701 WP_000729117.1.70123 WP_000729117.1.70125 WP_000729117.1.7013 WP_000729117.1.70149 WP_000729117.1.7015 WP_000729117.1.70190 WP_000729117.1.70191 WP_000729117.1.70200 WP_000729117.1.70213 WP_000729117.1.70230 WP_000729117.1.70251 WP_000729117.1.70256 WP_000729117.1.70300 WP_000729117.1.70337 WP_000729117.1.70341 WP_000729117.1.70357 WP_000729117.1.70370 WP_000729117.1.70386 WP_000729117.1.70407 WP_000729117.1.70408 WP_000729117.1.70414 WP_000729117.1.70477 WP_000729117.1.70492 WP_000729117.1.7050 WP_000729117.1.70509 WP_000729117.1.7052 WP_000729117.1.70530 WP_000729117.1.70539 WP_000729117.1.70563 WP_000729117.1.70576 WP_000729117.1.70578 WP_000729117.1.70582 WP_000729117.1.70592 WP_000729117.1.70597 WP_000729117.1.70600 WP_000729117.1.70628 WP_000729117.1.70655 WP_000729117.1.70656 WP_000729117.1.70686 WP_000729117.1.70694 WP_000729117.1.70698 WP_000729117.1.70705 WP_000729117.1.70713 WP_000729117.1.70723 WP_000729117.1.70728 WP_000729117.1.70745 WP_000729117.1.70747 WP_000729117.1.70748 WP_000729117.1.70767 WP_000729117.1.70787 WP_000729117.1.70794 WP_000729117.1.70801 WP_000729117.1.70803 WP_000729117.1.70880 WP_000729117.1.70896 WP_000729117.1.7090 WP_000729117.1.70900 WP_000729117.1.70967 WP_000729117.1.71003 WP_000729117.1.7102 WP_000729117.1.71024 WP_000729117.1.71037 WP_000729117.1.71042 WP_000729117.1.71062 WP_000729117.1.71099 WP_000729117.1.71109 WP_000729117.1.71113 WP_000729117.1.71134 WP_000729117.1.71139 WP_000729117.1.71144 WP_000729117.1.71147 WP_000729117.1.71149 WP_000729117.1.71158 WP_000729117.1.71159 WP_000729117.1.71162 WP_000729117.1.71170 WP_000729117.1.71176 WP_000729117.1.71183 WP_000729117.1.71192 WP_000729117.1.71199 WP_000729117.1.71205 WP_000729117.1.7121 WP_000729117.1.71221 WP_000729117.1.71223 WP_000729117.1.71225 WP_000729117.1.71226 WP_000729117.1.71229 WP_000729117.1.71264 WP_000729117.1.71269 WP_000729117.1.71272 WP_000729117.1.71273 WP_000729117.1.71275 WP_000729117.1.71285 WP_000729117.1.71287 WP_000729117.1.71294 WP_000729117.1.71311 WP_000729117.1.71312 WP_000729117.1.71315 WP_000729117.1.71323 WP_000729117.1.71327 WP_000729117.1.71339 WP_000729117.1.71354 WP_000729117.1.71397 WP_000729117.1.71403 WP_000729117.1.71405 WP_000729117.1.71421 WP_000729117.1.71423 WP_000729117.1.71448 WP_000729117.1.7147 WP_000729117.1.71480 WP_000729117.1.71522 WP_000729117.1.71533 WP_000729117.1.71537 WP_000729117.1.71540 WP_000729117.1.71560 WP_000729117.1.71562 WP_000729117.1.71563 WP_000729117.1.71603 WP_000729117.1.71607 WP_000729117.1.71632 WP_000729117.1.71680 WP_000729117.1.71690 WP_000729117.1.71695 WP_000729117.1.71712 WP_000729117.1.71724 WP_000729117.1.71732 WP_000729117.1.71757 WP_000729117.1.71767 WP_000729117.1.71783 WP_000729117.1.71830 WP_000729117.1.71832 WP_000729117.1.71837 WP_000729117.1.71840 WP_000729117.1.71855 WP_000729117.1.71856 WP_000729117.1.71874 WP_000729117.1.71912 WP_000729117.1.7192 WP_000729117.1.71922 WP_000729117.1.71938 WP_000729117.1.71939 WP_000729117.1.71940 WP_000729117.1.71944 WP_000729117.1.71945 WP_000729117.1.71967 WP_000729117.1.71972 WP_000729117.1.71975 WP_000729117.1.71987 WP_000729117.1.71993 WP_000729117.1.71995 WP_000729117.1.72013 WP_000729117.1.72016 WP_000729117.1.72021 WP_000729117.1.72028 WP_000729117.1.72033 WP_000729117.1.72048 WP_000729117.1.7205 WP_000729117.1.72053 WP_000729117.1.72054 WP_000729117.1.72066 WP_000729117.1.72090 WP_000729117.1.72098 WP_000729117.1.7210 WP_000729117.1.72117 WP_000729117.1.72120 WP_000729117.1.72125 WP_000729117.1.72126 WP_000729117.1.72141 WP_000729117.1.72153 WP_000729117.1.72155 WP_000729117.1.72157 WP_000729117.1.72161 WP_000729117.1.72162 WP_000729117.1.72180 WP_000729117.1.72184 WP_000729117.1.72186 WP_000729117.1.72208 WP_000729117.1.72212 WP_000729117.1.72237 WP_000729117.1.72248 WP_000729117.1.7225 WP_000729117.1.72261 WP_000729117.1.72262 WP_000729117.1.72270 WP_000729117.1.72279 WP_000729117.1.72290 WP_000729117.1.72293 WP_000729117.1.72298 WP_000729117.1.723 WP_000729117.1.72316 WP_000729117.1.72322 WP_000729117.1.72337 WP_000729117.1.72352 WP_000729117.1.72359 WP_000729117.1.72362 WP_000729117.1.72388 WP_000729117.1.72391 WP_000729117.1.72392 WP_000729117.1.72414 WP_000729117.1.72425 WP_000729117.1.72427 WP_000729117.1.72431 WP_000729117.1.72436 WP_000729117.1.72449 WP_000729117.1.72469 WP_000729117.1.72485 WP_000729117.1.72493 WP_000729117.1.72507 WP_000729117.1.72511 WP_000729117.1.72521 WP_000729117.1.72535 WP_000729117.1.72544 WP_000729117.1.72551 WP_000729117.1.72574 WP_000729117.1.72582 WP_000729117.1.72588 WP_000729117.1.72593 WP_000729117.1.72596 WP_000729117.1.72608 WP_000729117.1.72614 WP_000729117.1.72615 WP_000729117.1.72616 WP_000729117.1.72619 WP_000729117.1.72641 WP_000729117.1.72643 WP_000729117.1.72651 WP_000729117.1.72663 WP_000729117.1.72694 WP_000729117.1.72695 WP_000729117.1.72698 WP_000729117.1.72700 WP_000729117.1.72706 WP_000729117.1.72725 WP_000729117.1.72729 WP_000729117.1.72738 WP_000729117.1.72745 WP_000729117.1.72747 WP_000729117.1.72748 WP_000729117.1.72751 WP_000729117.1.72758 WP_000729117.1.72764 WP_000729117.1.7277 WP_000729117.1.72778 WP_000729117.1.72804 WP_000729117.1.72806 WP_000729117.1.7281 WP_000729117.1.72837 WP_000729117.1.72857 WP_000729117.1.72858 WP_000729117.1.72860 WP_000729117.1.72869 WP_000729117.1.72893 WP_000729117.1.7291 WP_000729117.1.72910 WP_000729117.1.72913 WP_000729117.1.72947 WP_000729117.1.72950 WP_000729117.1.72956 WP_000729117.1.72998 WP_000729117.1.73000 WP_000729117.1.73010 WP_000729117.1.73015 WP_000729117.1.73039 WP_000729117.1.73061 WP_000729117.1.7307 WP_000729117.1.73072 WP_000729117.1.73075 WP_000729117.1.73085 WP_000729117.1.7309 WP_000729117.1.73094 WP_000729117.1.73126 WP_000729117.1.73193 WP_000729117.1.73197 WP_000729117.1.73215 WP_000729117.1.73230 WP_000729117.1.73239 WP_000729117.1.73243 WP_000729117.1.73249 WP_000729117.1.73251 WP_000729117.1.73257 WP_000729117.1.73259 WP_000729117.1.73277 WP_000729117.1.73278 WP_000729117.1.73283 WP_000729117.1.73291 WP_000729117.1.73292 WP_000729117.1.73295 WP_000729117.1.73326 WP_000729117.1.73333 WP_000729117.1.73340 WP_000729117.1.73343 WP_000729117.1.73344 WP_000729117.1.73349 WP_000729117.1.73393 WP_000729117.1.73428 WP_000729117.1.73430 WP_000729117.1.7345 WP_000729117.1.73468 WP_000729117.1.73486 WP_000729117.1.7349 WP_000729117.1.73498 WP_000729117.1.73524 WP_000729117.1.73592 WP_000729117.1.73604 WP_000729117.1.73626 WP_000729117.1.73631 WP_000729117.1.73652 WP_000729117.1.73663 WP_000729117.1.73700 WP_000729117.1.73709 WP_000729117.1.73717 WP_000729117.1.73743 WP_000729117.1.73748 WP_000729117.1.7376 WP_000729117.1.73783 WP_000729117.1.73785 WP_000729117.1.73797 WP_000729117.1.73801 WP_000729117.1.73807 WP_000729117.1.73811 WP_000729117.1.73827 WP_000729117.1.73835 WP_000729117.1.73843 WP_000729117.1.73844 WP_000729117.1.73846 WP_000729117.1.73859 WP_000729117.1.73882 WP_000729117.1.73897 WP_000729117.1.73908 WP_000729117.1.7392 WP_000729117.1.73934 WP_000729117.1.73942 WP_000729117.1.73968 WP_000729117.1.73980 WP_000729117.1.73992 WP_000729117.1.73995 WP_000729117.1.73996 WP_000729117.1.74032 WP_000729117.1.74045 WP_000729117.1.74046 WP_000729117.1.74051 WP_000729117.1.74053 WP_000729117.1.7407 WP_000729117.1.74123 WP_000729117.1.7413 WP_000729117.1.74156 WP_000729117.1.74184 WP_000729117.1.74185 WP_000729117.1.74213 WP_000729117.1.74223 WP_000729117.1.74243 WP_000729117.1.7425 WP_000729117.1.74251 WP_000729117.1.74267 WP_000729117.1.7429 WP_000729117.1.74294 WP_000729117.1.74309 WP_000729117.1.74358 WP_000729117.1.74365 WP_000729117.1.74367 WP_000729117.1.744 WP_000729117.1.74423 WP_000729117.1.74431 WP_000729117.1.74444 WP_000729117.1.74445 WP_000729117.1.7446 WP_000729117.1.74465 WP_000729117.1.74478 WP_000729117.1.74491 WP_000729117.1.74501 WP_000729117.1.74509 WP_000729117.1.74513 WP_000729117.1.74520 WP_000729117.1.74521 WP_000729117.1.74528 WP_000729117.1.74532 WP_000729117.1.74536 WP_000729117.1.74549 WP_000729117.1.74557 WP_000729117.1.74574 WP_000729117.1.7461 WP_000729117.1.74611 WP_000729117.1.74623 WP_000729117.1.74624 WP_000729117.1.74625 WP_000729117.1.74631 WP_000729117.1.74652 WP_000729117.1.74670 WP_000729117.1.74682 WP_000729117.1.74687 WP_000729117.1.74688 WP_000729117.1.74689 WP_000729117.1.74691 WP_000729117.1.74705 WP_000729117.1.7471 WP_000729117.1.74713 WP_000729117.1.74716 WP_000729117.1.74720 WP_000729117.1.74735 WP_000729117.1.7475 WP_000729117.1.74765 WP_000729117.1.74767 WP_000729117.1.7478 WP_000729117.1.7479 WP_000729117.1.74793 WP_000729117.1.74811 WP_000729117.1.74844 WP_000729117.1.74852 WP_000729117.1.74854 WP_000729117.1.74860 WP_000729117.1.74867 WP_000729117.1.74873 WP_000729117.1.74879 WP_000729117.1.74880 WP_000729117.1.74885 WP_000729117.1.74889 WP_000729117.1.74895 WP_000729117.1.74904 WP_000729117.1.74914 WP_000729117.1.74915 WP_000729117.1.74962 WP_000729117.1.74975 WP_000729117.1.74993 WP_000729117.1.74998 WP_000729117.1.75003 WP_000729117.1.75021 WP_000729117.1.75029 WP_000729117.1.75030 WP_000729117.1.75050 WP_000729117.1.75087 WP_000729117.1.75100 WP_000729117.1.75112 WP_000729117.1.75118 WP_000729117.1.75124 WP_000729117.1.75136 WP_000729117.1.75138 WP_000729117.1.75139 WP_000729117.1.75143 WP_000729117.1.75145 WP_000729117.1.75149 WP_000729117.1.75155 WP_000729117.1.7516 WP_000729117.1.75164 WP_000729117.1.75181 WP_000729117.1.75209 WP_000729117.1.75218 WP_000729117.1.75219 WP_000729117.1.75221 WP_000729117.1.75228 WP_000729117.1.75247 WP_000729117.1.75248 WP_000729117.1.75254 WP_000729117.1.75270 WP_000729117.1.75272 WP_000729117.1.75306 WP_000729117.1.7536 WP_000729117.1.75360 WP_000729117.1.75367 WP_000729117.1.75382 WP_000729117.1.7539 WP_000729117.1.75419 WP_000729117.1.75428 WP_000729117.1.75435 WP_000729117.1.75465 WP_000729117.1.75491 WP_000729117.1.75505 WP_000729117.1.75507 WP_000729117.1.75515 WP_000729117.1.75529 WP_000729117.1.75536 WP_000729117.1.75537 WP_000729117.1.75557 WP_000729117.1.75568 WP_000729117.1.75577 WP_000729117.1.75588 WP_000729117.1.75594 WP_000729117.1.75602 WP_000729117.1.75612 WP_000729117.1.75629 WP_000729117.1.75644 WP_000729117.1.75653 WP_000729117.1.75672 WP_000729117.1.75676 WP_000729117.1.75679 WP_000729117.1.75687 WP_000729117.1.75694 WP_000729117.1.75696 WP_000729117.1.75698 WP_000729117.1.75699 WP_000729117.1.75725 WP_000729117.1.75735 WP_000729117.1.75758 WP_000729117.1.75767 WP_000729117.1.75803 WP_000729117.1.75808 WP_000729117.1.7583 WP_000729117.1.75839 WP_000729117.1.75853 WP_000729117.1.75918 WP_000729117.1.75922 WP_000729117.1.7597 WP_000729117.1.75973 WP_000729117.1.75989 WP_000729117.1.75995 WP_000729117.1.75999 WP_000729117.1.76005 WP_000729117.1.76009 WP_000729117.1.76019 WP_000729117.1.7603 WP_000729117.1.76030 WP_000729117.1.76036 WP_000729117.1.76039 WP_000729117.1.76054 WP_000729117.1.76057 WP_000729117.1.7608 WP_000729117.1.76087 WP_000729117.1.76089 WP_000729117.1.76103 WP_000729117.1.76118 WP_000729117.1.76119 WP_000729117.1.76129 WP_000729117.1.7613 WP_000729117.1.76152 WP_000729117.1.7617 WP_000729117.1.76184 WP_000729117.1.76189 WP_000729117.1.76194 WP_000729117.1.76196 WP_000729117.1.76211 WP_000729117.1.76237 WP_000729117.1.76268 WP_000729117.1.76269 WP_000729117.1.76305 WP_000729117.1.76312 WP_000729117.1.76325 WP_000729117.1.76335 WP_000729117.1.76361 WP_000729117.1.7637 WP_000729117.1.76384 WP_000729117.1.76387 WP_000729117.1.76390 WP_000729117.1.76407 WP_000729117.1.76446 WP_000729117.1.76447 WP_000729117.1.76448 WP_000729117.1.76452 WP_000729117.1.76460 WP_000729117.1.76462 WP_000729117.1.76466 WP_000729117.1.76477 WP_000729117.1.76504 WP_000729117.1.76542 WP_000729117.1.76544 WP_000729117.1.76547 WP_000729117.1.76562 WP_000729117.1.76595 WP_000729117.1.7661 WP_000729117.1.76612 WP_000729117.1.76619 WP_000729117.1.76643 WP_000729117.1.76656 WP_000729117.1.76697 WP_000729117.1.76701 WP_000729117.1.76705 WP_000729117.1.76707 WP_000729117.1.76712 WP_000729117.1.76751 WP_000729117.1.76759 WP_000729117.1.7680 WP_000729117.1.76815 WP_000729117.1.76827 WP_000729117.1.76831 WP_000729117.1.76840 WP_000729117.1.76863 WP_000729117.1.76884 WP_000729117.1.7689 WP_000729117.1.76909 WP_000729117.1.76918 WP_000729117.1.76933 WP_000729117.1.76948 WP_000729117.1.76957 WP_000729117.1.76965 WP_000729117.1.76966 WP_000729117.1.7699 WP_000729117.1.76994 WP_000729117.1.77007 WP_000729117.1.77015 WP_000729117.1.77022 WP_000729117.1.77036 WP_000729117.1.77042 WP_000729117.1.77070 WP_000729117.1.77081 WP_000729117.1.77099 WP_000729117.1.771 WP_000729117.1.77109 WP_000729117.1.77120 WP_000729117.1.77128 WP_000729117.1.77134 WP_000729117.1.77147 WP_000729117.1.77162 WP_000729117.1.77163 WP_000729117.1.77173 WP_000729117.1.77175 WP_000729117.1.77198 WP_000729117.1.77200 WP_000729117.1.77204 WP_000729117.1.77214 WP_000729117.1.77224 WP_000729117.1.77239 WP_000729117.1.77253 WP_000729117.1.77255 WP_000729117.1.77258 WP_000729117.1.77275 WP_000729117.1.7728 WP_000729117.1.77284 WP_000729117.1.77288 WP_000729117.1.7729 WP_000729117.1.77290 WP_000729117.1.77291 WP_000729117.1.77296 WP_000729117.1.7731 WP_000729117.1.77320 WP_000729117.1.77326 WP_000729117.1.77341 WP_000729117.1.77358 WP_000729117.1.77391 WP_000729117.1.77392 WP_000729117.1.77419 WP_000729117.1.77432 WP_000729117.1.77437 WP_000729117.1.77448 WP_000729117.1.77452 WP_000729117.1.77455 WP_000729117.1.77462 WP_000729117.1.7747 WP_000729117.1.77470 WP_000729117.1.77471 WP_000729117.1.77477 WP_000729117.1.77481 WP_000729117.1.77487 WP_000729117.1.77495 WP_000729117.1.775 WP_000729117.1.7750 WP_000729117.1.77503 WP_000729117.1.77511 WP_000729117.1.77542 WP_000729117.1.77551 WP_000729117.1.7756 WP_000729117.1.77577 WP_000729117.1.77581 WP_000729117.1.77595 WP_000729117.1.77600 WP_000729117.1.77608 WP_000729117.1.77626 WP_000729117.1.77632 WP_000729117.1.77636 WP_000729117.1.77643 WP_000729117.1.77644 WP_000729117.1.77657 WP_000729117.1.77707 WP_000729117.1.77725 WP_000729117.1.77741 WP_000729117.1.7775 WP_000729117.1.77760 WP_000729117.1.77767 WP_000729117.1.77768 WP_000729117.1.7780 WP_000729117.1.7781 WP_000729117.1.77813 WP_000729117.1.77816 WP_000729117.1.77826 WP_000729117.1.77833 WP_000729117.1.77876 WP_000729117.1.77929 WP_000729117.1.77949 WP_000729117.1.7795 WP_000729117.1.77950 WP_000729117.1.77961 WP_000729117.1.77979 WP_000729117.1.7799 WP_000729117.1.77999 WP_000729117.1.78000 WP_000729117.1.78007 WP_000729117.1.78010 WP_000729117.1.7804 WP_000729117.1.78041 WP_000729117.1.78059 WP_000729117.1.7806 WP_000729117.1.78063 WP_000729117.1.7808 WP_000729117.1.78089 WP_000729117.1.78097 WP_000729117.1.78099 WP_000729117.1.78101 WP_000729117.1.78102 WP_000729117.1.78131 WP_000729117.1.78183 WP_000729117.1.78187 WP_000729117.1.78188 WP_000729117.1.78196 WP_000729117.1.78202 WP_000729117.1.78233 WP_000729117.1.78235 WP_000729117.1.78297 WP_000729117.1.78305 WP_000729117.1.78321 WP_000729117.1.78323 WP_000729117.1.78337 WP_000729117.1.78340 WP_000729117.1.78368 WP_000729117.1.78376 WP_000729117.1.78377 WP_000729117.1.78390 WP_000729117.1.784 WP_000729117.1.78413 WP_000729117.1.78445 WP_000729117.1.78453 WP_000729117.1.78462 WP_000729117.1.78463 WP_000729117.1.78477 WP_000729117.1.78481 WP_000729117.1.78491 WP_000729117.1.7851 WP_000729117.1.78515 WP_000729117.1.78527 WP_000729117.1.7855 WP_000729117.1.78553 WP_000729117.1.78572 WP_000729117.1.78575 WP_000729117.1.78581 WP_000729117.1.78583 WP_000729117.1.78586 WP_000729117.1.78593 WP_000729117.1.78610 WP_000729117.1.78611 WP_000729117.1.78612 WP_000729117.1.78615 WP_000729117.1.78622 WP_000729117.1.78645 WP_000729117.1.78683 WP_000729117.1.78687 WP_000729117.1.78689 WP_000729117.1.78696 WP_000729117.1.78698 WP_000729117.1.78706 WP_000729117.1.78714 WP_000729117.1.78718 WP_000729117.1.78746 WP_000729117.1.78750 WP_000729117.1.78757 WP_000729117.1.78775 WP_000729117.1.78791 WP_000729117.1.78814 WP_000729117.1.7883 WP_000729117.1.78843 WP_000729117.1.78845 WP_000729117.1.78854 WP_000729117.1.78888 WP_000729117.1.78891 WP_000729117.1.78893 WP_000729117.1.78895 WP_000729117.1.78908 WP_000729117.1.78919 WP_000729117.1.78953 WP_000729117.1.78955 WP_000729117.1.78956 WP_000729117.1.7896 WP_000729117.1.78966 WP_000729117.1.7898 WP_000729117.1.78996 WP_000729117.1.79001 WP_000729117.1.79002 WP_000729117.1.7901 WP_000729117.1.79065 WP_000729117.1.79067 WP_000729117.1.79075 WP_000729117.1.79086 WP_000729117.1.79088 WP_000729117.1.79090 WP_000729117.1.79092 WP_000729117.1.79100 WP_000729117.1.79126 WP_000729117.1.79137 WP_000729117.1.79159 WP_000729117.1.79172 WP_000729117.1.79226 WP_000729117.1.79233 WP_000729117.1.79243 WP_000729117.1.79248 WP_000729117.1.79249 WP_000729117.1.79276 WP_000729117.1.79306 WP_000729117.1.79308 WP_000729117.1.79312 WP_000729117.1.79342 WP_000729117.1.79343 WP_000729117.1.79346 WP_000729117.1.79348 WP_000729117.1.79356 WP_000729117.1.79368 WP_000729117.1.79369 WP_000729117.1.7937 WP_000729117.1.79389 WP_000729117.1.79391 WP_000729117.1.7940 WP_000729117.1.79409 WP_000729117.1.79414 WP_000729117.1.79416 WP_000729117.1.79443 WP_000729117.1.79464 WP_000729117.1.79478 WP_000729117.1.79505 WP_000729117.1.79519 WP_000729117.1.7952 WP_000729117.1.79525 WP_000729117.1.79528 WP_000729117.1.79540 WP_000729117.1.79558 WP_000729117.1.79563 WP_000729117.1.79576 WP_000729117.1.79591 WP_000729117.1.79606 WP_000729117.1.79619 WP_000729117.1.79640 WP_000729117.1.7967 WP_000729117.1.79685 WP_000729117.1.79707 WP_000729117.1.79713 WP_000729117.1.79715 WP_000729117.1.79749 WP_000729117.1.79759 WP_000729117.1.79800 WP_000729117.1.79816 WP_000729117.1.79824 WP_000729117.1.79840 WP_000729117.1.7985 WP_000729117.1.79866 WP_000729117.1.79869 WP_000729117.1.7987 WP_000729117.1.79871 WP_000729117.1.79877 WP_000729117.1.79905 WP_000729117.1.79922 WP_000729117.1.7993 WP_000729117.1.79930 WP_000729117.1.79931 WP_000729117.1.79932 WP_000729117.1.79933 WP_000729117.1.79936 WP_000729117.1.79944 WP_000729117.1.79952 WP_000729117.1.79955 WP_000729117.1.79965 WP_000729117.1.79973 WP_000729117.1.79984 WP_000729117.1.79995 WP_000729117.1.80 WP_000729117.1.80011 WP_000729117.1.80016 WP_000729117.1.80026 WP_000729117.1.8004 WP_000729117.1.80043 WP_000729117.1.80050 WP_000729117.1.80060 WP_000729117.1.80061 WP_000729117.1.80063 WP_000729117.1.8007 WP_000729117.1.80071 WP_000729117.1.80096 WP_000729117.1.80106 WP_000729117.1.8011 WP_000729117.1.80112 WP_000729117.1.80136 WP_000729117.1.80141 WP_000729117.1.80168 WP_000729117.1.80176 WP_000729117.1.80179 WP_000729117.1.80183 WP_000729117.1.80192 WP_000729117.1.80255 WP_000729117.1.80292 WP_000729117.1.80309 WP_000729117.1.80310 WP_000729117.1.80320 WP_000729117.1.80330 WP_000729117.1.80343 WP_000729117.1.80388 WP_000729117.1.80392 WP_000729117.1.804 WP_000729117.1.80402 WP_000729117.1.80426 WP_000729117.1.80428 WP_000729117.1.80440 WP_000729117.1.80444 WP_000729117.1.80456 WP_000729117.1.80463 WP_000729117.1.80484 WP_000729117.1.80517 WP_000729117.1.80519 WP_000729117.1.80524 WP_000729117.1.80545 WP_000729117.1.80558 WP_000729117.1.80577 WP_000729117.1.80578 WP_000729117.1.80594 WP_000729117.1.80606 WP_000729117.1.80626 WP_000729117.1.80660 WP_000729117.1.80662 WP_000729117.1.80676 WP_000729117.1.8068 WP_000729117.1.80709 WP_000729117.1.80718 WP_000729117.1.80731 WP_000729117.1.80736 WP_000729117.1.8074 WP_000729117.1.80753 WP_000729117.1.80754 WP_000729117.1.80756 WP_000729117.1.8076 WP_000729117.1.80768 WP_000729117.1.80789 WP_000729117.1.808 WP_000729117.1.80804 WP_000729117.1.80843 WP_000729117.1.80862 WP_000729117.1.80882 WP_000729117.1.80894 WP_000729117.1.8090 WP_000729117.1.8091 WP_000729117.1.80935 WP_000729117.1.80945 WP_000729117.1.80946 WP_000729117.1.80948 WP_000729117.1.80954 WP_000729117.1.80966 WP_000729117.1.80983 WP_000729117.1.80985 WP_000729117.1.810 WP_000729117.1.81026 WP_000729117.1.81032 WP_000729117.1.81034 WP_000729117.1.81036 WP_000729117.1.81054 WP_000729117.1.81056 WP_000729117.1.81070 WP_000729117.1.81071 WP_000729117.1.81098 WP_000729117.1.811 WP_000729117.1.81104 WP_000729117.1.81120 WP_000729117.1.81141 WP_000729117.1.81156 WP_000729117.1.81160 WP_000729117.1.81165 WP_000729117.1.8118 WP_000729117.1.81180 WP_000729117.1.81182 WP_000729117.1.81186 WP_000729117.1.8121 WP_000729117.1.81219 WP_000729117.1.81266 WP_000729117.1.81267 WP_000729117.1.81273 WP_000729117.1.81281 WP_000729117.1.81283 WP_000729117.1.81286 WP_000729117.1.8129 WP_000729117.1.81298 WP_000729117.1.81313 WP_000729117.1.81316 WP_000729117.1.81323 WP_000729117.1.81347 WP_000729117.1.81376 WP_000729117.1.81391 WP_000729117.1.81396 WP_000729117.1.814 WP_000729117.1.81418 WP_000729117.1.81420 WP_000729117.1.81423 WP_000729117.1.81438 WP_000729117.1.81442 WP_000729117.1.81469 WP_000729117.1.81475 WP_000729117.1.81484 WP_000729117.1.81514 WP_000729117.1.8156 WP_000729117.1.81576 WP_000729117.1.81577 WP_000729117.1.81580 WP_000729117.1.81582 WP_000729117.1.81588 WP_000729117.1.81589 WP_000729117.1.81596 WP_000729117.1.81602 WP_000729117.1.81624 WP_000729117.1.81625 WP_000729117.1.81688 WP_000729117.1.81692 WP_000729117.1.81715 WP_000729117.1.8172 WP_000729117.1.81723 WP_000729117.1.81754 WP_000729117.1.81761 WP_000729117.1.81806 WP_000729117.1.81819 WP_000729117.1.81821 WP_000729117.1.8183 WP_000729117.1.81832 WP_000729117.1.81843 WP_000729117.1.81873 WP_000729117.1.81876 WP_000729117.1.81881 WP_000729117.1.81888 WP_000729117.1.81914 WP_000729117.1.81934 WP_000729117.1.81935 WP_000729117.1.81939 WP_000729117.1.81952 WP_000729117.1.81956 WP_000729117.1.81972 WP_000729117.1.81975 WP_000729117.1.82 WP_000729117.1.82008 WP_000729117.1.82010 WP_000729117.1.82057 WP_000729117.1.82061 WP_000729117.1.82074 WP_000729117.1.82095 WP_000729117.1.82104 WP_000729117.1.82106 WP_000729117.1.82116 WP_000729117.1.82123 WP_000729117.1.82137 WP_000729117.1.82166 WP_000729117.1.82221 WP_000729117.1.82239 WP_000729117.1.82240 WP_000729117.1.82246 WP_000729117.1.82280 WP_000729117.1.82296 WP_000729117.1.82316 WP_000729117.1.82320 WP_000729117.1.82330 WP_000729117.1.8235 WP_000729117.1.82378 WP_000729117.1.82438 WP_000729117.1.82439 WP_000729117.1.82485 WP_000729117.1.82499 WP_000729117.1.82507 WP_000729117.1.82514 WP_000729117.1.82527 WP_000729117.1.82536 WP_000729117.1.8255 WP_000729117.1.82572 WP_000729117.1.82589 WP_000729117.1.82594 WP_000729117.1.82614 WP_000729117.1.82626 WP_000729117.1.82629 WP_000729117.1.82647 WP_000729117.1.82661 WP_000729117.1.8268 WP_000729117.1.82682 WP_000729117.1.82691 WP_000729117.1.82698 WP_000729117.1.82711 WP_000729117.1.82715 WP_000729117.1.82718 WP_000729117.1.82747 WP_000729117.1.82754 WP_000729117.1.8277 WP_000729117.1.82776 WP_000729117.1.82780 WP_000729117.1.82784 WP_000729117.1.82799 WP_000729117.1.82808 WP_000729117.1.82816 WP_000729117.1.82820 WP_000729117.1.82831 WP_000729117.1.82833 WP_000729117.1.82853 WP_000729117.1.82901 WP_000729117.1.82923 WP_000729117.1.8295 WP_000729117.1.82991 WP_000729117.1.83033 WP_000729117.1.83035 WP_000729117.1.83036 WP_000729117.1.83051 WP_000729117.1.83059 WP_000729117.1.8306 WP_000729117.1.8308 WP_000729117.1.83093 WP_000729117.1.83097 WP_000729117.1.83099 WP_000729117.1.831 WP_000729117.1.83118 WP_000729117.1.83125 WP_000729117.1.83127 WP_000729117.1.83140 WP_000729117.1.83144 WP_000729117.1.83151 WP_000729117.1.83160 WP_000729117.1.83177 WP_000729117.1.83205 WP_000729117.1.83214 WP_000729117.1.83218 WP_000729117.1.83224 WP_000729117.1.83238 WP_000729117.1.83253 WP_000729117.1.83256 WP_000729117.1.83286 WP_000729117.1.83313 WP_000729117.1.83321 WP_000729117.1.83330 WP_000729117.1.83340 WP_000729117.1.83347 WP_000729117.1.83375 WP_000729117.1.83393 WP_000729117.1.83415 WP_000729117.1.8345 WP_000729117.1.83466 WP_000729117.1.83481 WP_000729117.1.83506 WP_000729117.1.83537 WP_000729117.1.83544 WP_000729117.1.83564 WP_000729117.1.83582 WP_000729117.1.83644 WP_000729117.1.83660 WP_000729117.1.83668 WP_000729117.1.8368 WP_000729117.1.83684 WP_000729117.1.83706 WP_000729117.1.83712 WP_000729117.1.83781 WP_000729117.1.83807 WP_000729117.1.83820 WP_000729117.1.8384 WP_000729117.1.8386 WP_000729117.1.83879 WP_000729117.1.83936 WP_000729117.1.83941 WP_000729117.1.83947 WP_000729117.1.84004 WP_000729117.1.84021 WP_000729117.1.84059 WP_000729117.1.84074 WP_000729117.1.8408 WP_000729117.1.8411 WP_000729117.1.84140 WP_000729117.1.84164 WP_000729117.1.84172 WP_000729117.1.84185 WP_000729117.1.84197 WP_000729117.1.84210 WP_000729117.1.84215 WP_000729117.1.84219 WP_000729117.1.84221 WP_000729117.1.84264 WP_000729117.1.84298 WP_000729117.1.84312 WP_000729117.1.84313 WP_000729117.1.84316 WP_000729117.1.84319 WP_000729117.1.84326 WP_000729117.1.84339 WP_000729117.1.84348 WP_000729117.1.84405 WP_000729117.1.84410 WP_000729117.1.84436 WP_000729117.1.8444 WP_000729117.1.84462 WP_000729117.1.84464 WP_000729117.1.84467 WP_000729117.1.8447 WP_000729117.1.84473 WP_000729117.1.84476 WP_000729117.1.84482 WP_000729117.1.84484 WP_000729117.1.84486 WP_000729117.1.84511 WP_000729117.1.84518 WP_000729117.1.84531 WP_000729117.1.84534 WP_000729117.1.84584 WP_000729117.1.84635 WP_000729117.1.84639 WP_000729117.1.84656 WP_000729117.1.84657 WP_000729117.1.84668 WP_000729117.1.84697 WP_000729117.1.8470 WP_000729117.1.84731 WP_000729117.1.84738 WP_000729117.1.84740 WP_000729117.1.84768 WP_000729117.1.8477 WP_000729117.1.84797 WP_000729117.1.84841 WP_000729117.1.84850 WP_000729117.1.84875 WP_000729117.1.84877 WP_000729117.1.84878 WP_000729117.1.84881 WP_000729117.1.84893 WP_000729117.1.84894 WP_000729117.1.84916 WP_000729117.1.84929 WP_000729117.1.84941 WP_000729117.1.84948 WP_000729117.1.84966 WP_000729117.1.84972 WP_000729117.1.84977 WP_000729117.1.84986 WP_000729117.1.84989 WP_000729117.1.84990 WP_000729117.1.84994 WP_000729117.1.85002 WP_000729117.1.85008 WP_000729117.1.85011 WP_000729117.1.85025 WP_000729117.1.85048 WP_000729117.1.85052 WP_000729117.1.85077 WP_000729117.1.85085 WP_000729117.1.85090 WP_000729117.1.85098 WP_000729117.1.85105 WP_000729117.1.85106 WP_000729117.1.85112 WP_000729117.1.85125 WP_000729117.1.85129 WP_000729117.1.85138 WP_000729117.1.85141 WP_000729117.1.85156 WP_000729117.1.85175 WP_000729117.1.85188 WP_000729117.1.85216 WP_000729117.1.85241 WP_000729117.1.85247 WP_000729117.1.85252 WP_000729117.1.85253 WP_000729117.1.85255 WP_000729117.1.85260 WP_000729117.1.8530 WP_000729117.1.85305 WP_000729117.1.85310 WP_000729117.1.85315 WP_000729117.1.85320 WP_000729117.1.85323 WP_000729117.1.85329 WP_000729117.1.85335 WP_000729117.1.85342 WP_000729117.1.85361 WP_000729117.1.85369 WP_000729117.1.85384 WP_000729117.1.85385 WP_000729117.1.85416 WP_000729117.1.85435 WP_000729117.1.85500 WP_000729117.1.85504 WP_000729117.1.85525 WP_000729117.1.85546 WP_000729117.1.85554 WP_000729117.1.85556 WP_000729117.1.85558 WP_000729117.1.85563 WP_000729117.1.85578 WP_000729117.1.85593 WP_000729117.1.8560 WP_000729117.1.85601 WP_000729117.1.85621 WP_000729117.1.85623 WP_000729117.1.8564 WP_000729117.1.85657 WP_000729117.1.85685 WP_000729117.1.85722 WP_000729117.1.85752 WP_000729117.1.85762 WP_000729117.1.85767 WP_000729117.1.85772 WP_000729117.1.85773 WP_000729117.1.85781 WP_000729117.1.8579 WP_000729117.1.85793 WP_000729117.1.85800 WP_000729117.1.85806 WP_000729117.1.85857 WP_000729117.1.85895 WP_000729117.1.8592 WP_000729117.1.85939 WP_000729117.1.85944 WP_000729117.1.85948 WP_000729117.1.85969 WP_000729117.1.86 WP_000729117.1.86001 WP_000729117.1.86016 WP_000729117.1.8603 WP_000729117.1.86035 WP_000729117.1.86063 WP_000729117.1.8607 WP_000729117.1.86104 WP_000729117.1.86105 WP_000729117.1.86110 WP_000729117.1.86115 WP_000729117.1.86145 WP_000729117.1.86149 WP_000729117.1.86171 WP_000729117.1.86179 WP_000729117.1.86181 WP_000729117.1.86189 WP_000729117.1.86196 WP_000729117.1.8621 WP_000729117.1.86210 WP_000729117.1.86225 WP_000729117.1.86227 WP_000729117.1.86228 WP_000729117.1.86234 WP_000729117.1.86255 WP_000729117.1.86261 WP_000729117.1.86263 WP_000729117.1.86266 WP_000729117.1.86273 WP_000729117.1.86276 WP_000729117.1.86280 WP_000729117.1.86283 WP_000729117.1.86294 WP_000729117.1.86307 WP_000729117.1.86340 WP_000729117.1.8635 WP_000729117.1.86353 WP_000729117.1.86355 WP_000729117.1.86371 WP_000729117.1.86393 WP_000729117.1.86411 WP_000729117.1.86437 WP_000729117.1.86451 WP_000729117.1.86452 WP_000729117.1.86454 WP_000729117.1.86461 WP_000729117.1.86475 WP_000729117.1.86483 WP_000729117.1.86492 WP_000729117.1.86518 WP_000729117.1.8652 WP_000729117.1.8656 WP_000729117.1.86560 WP_000729117.1.86574 WP_000729117.1.86583 WP_000729117.1.86598 WP_000729117.1.86609 WP_000729117.1.86613 WP_000729117.1.86617 WP_000729117.1.86627 WP_000729117.1.86640 WP_000729117.1.86667 WP_000729117.1.86673 WP_000729117.1.86674 WP_000729117.1.86681 WP_000729117.1.86691 WP_000729117.1.86707 WP_000729117.1.86717 WP_000729117.1.86727 WP_000729117.1.86734 WP_000729117.1.86753 WP_000729117.1.86760 WP_000729117.1.86768 WP_000729117.1.86787 WP_000729117.1.86788 WP_000729117.1.8679 WP_000729117.1.86833 WP_000729117.1.86846 WP_000729117.1.86848 WP_000729117.1.8687 WP_000729117.1.86935 WP_000729117.1.86956 WP_000729117.1.86959 WP_000729117.1.86975 WP_000729117.1.86994 WP_000729117.1.86997 WP_000729117.1.87043 WP_000729117.1.8705 WP_000729117.1.87059 WP_000729117.1.87074 WP_000729117.1.87075 WP_000729117.1.87076 WP_000729117.1.87102 WP_000729117.1.87109 WP_000729117.1.8711 WP_000729117.1.87147 WP_000729117.1.87177 WP_000729117.1.87189 WP_000729117.1.87199 WP_000729117.1.87205 WP_000729117.1.87247 WP_000729117.1.87249 WP_000729117.1.87254 WP_000729117.1.87310 WP_000729117.1.87339 WP_000729117.1.87358 WP_000729117.1.87371 WP_000729117.1.87382 WP_000729117.1.87389 WP_000729117.1.87400 WP_000729117.1.87443 WP_000729117.1.87465 WP_000729117.1.87491 WP_000729117.1.87504 WP_000729117.1.87557 WP_000729117.1.87563 WP_000729117.1.87568 WP_000729117.1.87574 WP_000729117.1.87581 WP_000729117.1.87590 WP_000729117.1.87608 WP_000729117.1.87610 WP_000729117.1.87616 WP_000729117.1.87633 WP_000729117.1.87635 WP_000729117.1.87639 WP_000729117.1.87655 WP_000729117.1.87675 WP_000729117.1.87694 WP_000729117.1.87696 WP_000729117.1.8771 WP_000729117.1.87721 WP_000729117.1.87726 WP_000729117.1.87766 WP_000729117.1.8778 WP_000729117.1.87786 WP_000729117.1.87788 WP_000729117.1.87789 WP_000729117.1.87834 WP_000729117.1.87857 WP_000729117.1.87883 WP_000729117.1.87914 WP_000729117.1.87919 WP_000729117.1.87973 WP_000729117.1.87980 WP_000729117.1.87984 WP_000729117.1.87989 WP_000729117.1.87990 WP_000729117.1.880 WP_000729117.1.88017 WP_000729117.1.88020 WP_000729117.1.88066 WP_000729117.1.8807 WP_000729117.1.88082 WP_000729117.1.88088 WP_000729117.1.88110 WP_000729117.1.88119 WP_000729117.1.88147 WP_000729117.1.88149 WP_000729117.1.88155 WP_000729117.1.88189 WP_000729117.1.88197 WP_000729117.1.8822 WP_000729117.1.88234 WP_000729117.1.88238 WP_000729117.1.88252 WP_000729117.1.88260 WP_000729117.1.88263 WP_000729117.1.88285 WP_000729117.1.88301 WP_000729117.1.88336 WP_000729117.1.88352 WP_000729117.1.88376 WP_000729117.1.88379 WP_000729117.1.88384 WP_000729117.1.88413 WP_000729117.1.88427 WP_000729117.1.8843 WP_000729117.1.88434 WP_000729117.1.88438 WP_000729117.1.88462 WP_000729117.1.88467 WP_000729117.1.8848 WP_000729117.1.88499 WP_000729117.1.88505 WP_000729117.1.88524 WP_000729117.1.88527 WP_000729117.1.88528 WP_000729117.1.88535 WP_000729117.1.88539 WP_000729117.1.8854 WP_000729117.1.8855 WP_000729117.1.88557 WP_000729117.1.88562 WP_000729117.1.88577 WP_000729117.1.88598 WP_000729117.1.88603 WP_000729117.1.88607 WP_000729117.1.88646 WP_000729117.1.88667 WP_000729117.1.88678 WP_000729117.1.88685 WP_000729117.1.88686 WP_000729117.1.88709 WP_000729117.1.88710 WP_000729117.1.88711 WP_000729117.1.88717 WP_000729117.1.88720 WP_000729117.1.88729 WP_000729117.1.88732 WP_000729117.1.88735 WP_000729117.1.88752 WP_000729117.1.88757 WP_000729117.1.88759 WP_000729117.1.88767 WP_000729117.1.8879 WP_000729117.1.88793 WP_000729117.1.88803 WP_000729117.1.88826 WP_000729117.1.88834 WP_000729117.1.88864 WP_000729117.1.88880 WP_000729117.1.88883 WP_000729117.1.88891 WP_000729117.1.88941 WP_000729117.1.88950 WP_000729117.1.88953 WP_000729117.1.88997 WP_000729117.1.89018 WP_000729117.1.89050 WP_000729117.1.8906 WP_000729117.1.89067 WP_000729117.1.89069 WP_000729117.1.89090 WP_000729117.1.89097 WP_000729117.1.89099 WP_000729117.1.89111 WP_000729117.1.89163 WP_000729117.1.89165 WP_000729117.1.89183 WP_000729117.1.89197 WP_000729117.1.89200 WP_000729117.1.89203 WP_000729117.1.89214 WP_000729117.1.89255 WP_000729117.1.8928 WP_000729117.1.89285 WP_000729117.1.89305 WP_000729117.1.89312 WP_000729117.1.89322 WP_000729117.1.89334 WP_000729117.1.89335 WP_000729117.1.89351 WP_000729117.1.8938 WP_000729117.1.89385 WP_000729117.1.89396 WP_000729117.1.894 WP_000729117.1.89400 WP_000729117.1.89403 WP_000729117.1.89405 WP_000729117.1.89416 WP_000729117.1.89427 WP_000729117.1.89432 WP_000729117.1.8945 WP_000729117.1.89455 WP_000729117.1.89458 WP_000729117.1.89466 WP_000729117.1.89468 WP_000729117.1.89469 WP_000729117.1.89471 WP_000729117.1.89474 WP_000729117.1.89479 WP_000729117.1.89492 WP_000729117.1.89510 WP_000729117.1.89551 WP_000729117.1.89569 WP_000729117.1.89583 WP_000729117.1.89601 WP_000729117.1.89605 WP_000729117.1.89627 WP_000729117.1.89631 WP_000729117.1.89656 WP_000729117.1.89674 WP_000729117.1.89679 WP_000729117.1.89700 WP_000729117.1.89710 WP_000729117.1.89747 WP_000729117.1.89768 WP_000729117.1.89781 WP_000729117.1.89788 WP_000729117.1.89818 WP_000729117.1.89839 WP_000729117.1.89841 WP_000729117.1.89852 WP_000729117.1.89859 WP_000729117.1.89879 WP_000729117.1.89895 WP_000729117.1.89899 WP_000729117.1.89915 WP_000729117.1.89917 WP_000729117.1.89918 WP_000729117.1.89920 WP_000729117.1.89925 WP_000729117.1.89927 WP_000729117.1.89977 WP_000729117.1.89988 WP_000729117.1.89998 WP_000729117.1.90017 WP_000729117.1.90022 WP_000729117.1.90050 WP_000729117.1.90065 WP_000729117.1.90078 WP_000729117.1.9009 WP_000729117.1.9010 WP_000729117.1.90115 WP_000729117.1.90139 WP_000729117.1.90146 WP_000729117.1.90156 WP_000729117.1.90168 WP_000729117.1.90171 WP_000729117.1.90182 WP_000729117.1.902 WP_000729117.1.90205 WP_000729117.1.90219 WP_000729117.1.90249 WP_000729117.1.90256 WP_000729117.1.90257 WP_000729117.1.90266 WP_000729117.1.90270 WP_000729117.1.90314 WP_000729117.1.90332 WP_000729117.1.90342 WP_000729117.1.90346 WP_000729117.1.90349 WP_000729117.1.90357 WP_000729117.1.9036 WP_000729117.1.90389 WP_000729117.1.90405 WP_000729117.1.90436 WP_000729117.1.90441 WP_000729117.1.90449 WP_000729117.1.90467 WP_000729117.1.90511 WP_000729117.1.90520 WP_000729117.1.90525 WP_000729117.1.90536 WP_000729117.1.90542 WP_000729117.1.90547 WP_000729117.1.9059 WP_000729117.1.90591 WP_000729117.1.90602 WP_000729117.1.9061 WP_000729117.1.90626 WP_000729117.1.90690 WP_000729117.1.90703 WP_000729117.1.90706 WP_000729117.1.90758 WP_000729117.1.90775 WP_000729117.1.90799 WP_000729117.1.9081 WP_000729117.1.90813 WP_000729117.1.90828 WP_000729117.1.90834 WP_000729117.1.90837 WP_000729117.1.90839 WP_000729117.1.9084 WP_000729117.1.90842 WP_000729117.1.90844 WP_000729117.1.90848 WP_000729117.1.90856 WP_000729117.1.90864 WP_000729117.1.9087 WP_000729117.1.90873 WP_000729117.1.90890 WP_000729117.1.909 WP_000729117.1.90905 WP_000729117.1.90924 WP_000729117.1.90951 WP_000729117.1.90960 WP_000729117.1.90967 WP_000729117.1.90979 WP_000729117.1.9098 WP_000729117.1.90988 WP_000729117.1.90996 WP_000729117.1.90997 WP_000729117.1.91 WP_000729117.1.91007 WP_000729117.1.91010 WP_000729117.1.91018 WP_000729117.1.91072 WP_000729117.1.91088 WP_000729117.1.91094 WP_000729117.1.91117 WP_000729117.1.91121 WP_000729117.1.91138 WP_000729117.1.91143 WP_000729117.1.91153 WP_000729117.1.9118 WP_000729117.1.91182 WP_000729117.1.9119 WP_000729117.1.91213 WP_000729117.1.91266 WP_000729117.1.91268 WP_000729117.1.91277 WP_000729117.1.91288 WP_000729117.1.91290 WP_000729117.1.91340 WP_000729117.1.91341 WP_000729117.1.91354 WP_000729117.1.91356 WP_000729117.1.91361 WP_000729117.1.91384 WP_000729117.1.91397 WP_000729117.1.91414 WP_000729117.1.91425 WP_000729117.1.91445 WP_000729117.1.91462 WP_000729117.1.91482 WP_000729117.1.91485 WP_000729117.1.915 WP_000729117.1.91511 WP_000729117.1.91515 WP_000729117.1.91516 WP_000729117.1.91526 WP_000729117.1.91543 WP_000729117.1.91548 WP_000729117.1.91549 WP_000729117.1.91551 WP_000729117.1.91565 WP_000729117.1.91566 WP_000729117.1.9157 WP_000729117.1.91594 WP_000729117.1.91596 WP_000729117.1.9160 WP_000729117.1.91626 WP_000729117.1.91630 WP_000729117.1.91640 WP_000729117.1.91643 WP_000729117.1.91644 WP_000729117.1.91651 WP_000729117.1.91666 WP_000729117.1.91672 WP_000729117.1.9168 WP_000729117.1.91685 WP_000729117.1.9169 WP_000729117.1.91701 WP_000729117.1.9171 WP_000729117.1.91739 WP_000729117.1.91756 WP_000729117.1.91777 WP_000729117.1.91779 WP_000729117.1.91782 WP_000729117.1.91787 WP_000729117.1.91793 WP_000729117.1.91801 WP_000729117.1.91814 WP_000729117.1.91843 WP_000729117.1.9185 WP_000729117.1.91850 WP_000729117.1.91863 WP_000729117.1.91871 WP_000729117.1.91879 WP_000729117.1.91887 WP_000729117.1.91893 WP_000729117.1.91951 WP_000729117.1.91954 WP_000729117.1.91959 WP_000729117.1.91965 WP_000729117.1.91971 WP_000729117.1.9199 WP_000729117.1.91994 WP_000729117.1.92005 WP_000729117.1.92014 WP_000729117.1.92019 WP_000729117.1.92025 WP_000729117.1.92029 WP_000729117.1.92031 WP_000729117.1.92048 WP_000729117.1.92053 WP_000729117.1.92058 WP_000729117.1.9209 WP_000729117.1.921 WP_000729117.1.92102 WP_000729117.1.92114 WP_000729117.1.92123 WP_000729117.1.9215 WP_000729117.1.92161 WP_000729117.1.92163 WP_000729117.1.92180 WP_000729117.1.92195 WP_000729117.1.92201 WP_000729117.1.92215 WP_000729117.1.92224 WP_000729117.1.92276 WP_000729117.1.92295 WP_000729117.1.92304 WP_000729117.1.92305 WP_000729117.1.92311 WP_000729117.1.92361 WP_000729117.1.92384 WP_000729117.1.92403 WP_000729117.1.92434 WP_000729117.1.92462 WP_000729117.1.92473 WP_000729117.1.92495 WP_000729117.1.92496 WP_000729117.1.92506 WP_000729117.1.92532 WP_000729117.1.92535 WP_000729117.1.9255 WP_000729117.1.92568 WP_000729117.1.92571 WP_000729117.1.92577 WP_000729117.1.92614 WP_000729117.1.92615 WP_000729117.1.92634 WP_000729117.1.92638 WP_000729117.1.9264 WP_000729117.1.92648 WP_000729117.1.9266 WP_000729117.1.92668 WP_000729117.1.92693 WP_000729117.1.92708 WP_000729117.1.92719 WP_000729117.1.92742 WP_000729117.1.92750 WP_000729117.1.92767 WP_000729117.1.92780 WP_000729117.1.92781 WP_000729117.1.92792 WP_000729117.1.92793 WP_000729117.1.92796 WP_000729117.1.92819 WP_000729117.1.92845 WP_000729117.1.92865 WP_000729117.1.92882 WP_000729117.1.92886 WP_000729117.1.92932 WP_000729117.1.92943 WP_000729117.1.92953 WP_000729117.1.92989 WP_000729117.1.92991 WP_000729117.1.93005 WP_000729117.1.93016 WP_000729117.1.93017 WP_000729117.1.93019 WP_000729117.1.93023 WP_000729117.1.93027 WP_000729117.1.93033 WP_000729117.1.93048 WP_000729117.1.93052 WP_000729117.1.93054 WP_000729117.1.93069 WP_000729117.1.93072 WP_000729117.1.93085 WP_000729117.1.93112 WP_000729117.1.93138 WP_000729117.1.93139 WP_000729117.1.93150 WP_000729117.1.93167 WP_000729117.1.93175 WP_000729117.1.93185 WP_000729117.1.93233 WP_000729117.1.93252 WP_000729117.1.93267 WP_000729117.1.9327 WP_000729117.1.93276 WP_000729117.1.93291 WP_000729117.1.93309 WP_000729117.1.9331 WP_000729117.1.93312 WP_000729117.1.93326 WP_000729117.1.93338 WP_000729117.1.93379 WP_000729117.1.93388 WP_000729117.1.93427 WP_000729117.1.93428 WP_000729117.1.93431 WP_000729117.1.93453 WP_000729117.1.93461 WP_000729117.1.93463 WP_000729117.1.93464 WP_000729117.1.93468 WP_000729117.1.93509 WP_000729117.1.93531 WP_000729117.1.93533 WP_000729117.1.93552 WP_000729117.1.9356 WP_000729117.1.93601 WP_000729117.1.93605 WP_000729117.1.93621 WP_000729117.1.93626 WP_000729117.1.93629 WP_000729117.1.93630 WP_000729117.1.93634 WP_000729117.1.93637 WP_000729117.1.93652 WP_000729117.1.93665 WP_000729117.1.93670 WP_000729117.1.93673 WP_000729117.1.93679 WP_000729117.1.93694 WP_000729117.1.93695 WP_000729117.1.93716 WP_000729117.1.93733 WP_000729117.1.93737 WP_000729117.1.93742 WP_000729117.1.93743 WP_000729117.1.93745 WP_000729117.1.93755 WP_000729117.1.93765 WP_000729117.1.93768 WP_000729117.1.938 WP_000729117.1.93800 WP_000729117.1.93821 WP_000729117.1.93870 WP_000729117.1.93873 WP_000729117.1.93877 WP_000729117.1.939 WP_000729117.1.93900 WP_000729117.1.93911 WP_000729117.1.93918 WP_000729117.1.93921 WP_000729117.1.93922 WP_000729117.1.93939 WP_000729117.1.93951 WP_000729117.1.93952 WP_000729117.1.93971 WP_000729117.1.94008 WP_000729117.1.94011 WP_000729117.1.94025 WP_000729117.1.94028 WP_000729117.1.94035 WP_000729117.1.94040 WP_000729117.1.94057 WP_000729117.1.94069 WP_000729117.1.94156 WP_000729117.1.9416 WP_000729117.1.94176 WP_000729117.1.94187 WP_000729117.1.94190 WP_000729117.1.9420 WP_000729117.1.94213 WP_000729117.1.94232 WP_000729117.1.94271 WP_000729117.1.94282 WP_000729117.1.94298 WP_000729117.1.94302 WP_000729117.1.94317 WP_000729117.1.94343 WP_000729117.1.94353 WP_000729117.1.94367 WP_000729117.1.94388 WP_000729117.1.94404 WP_000729117.1.94417 WP_000729117.1.94429 WP_000729117.1.94430 WP_000729117.1.94436 WP_000729117.1.94438 WP_000729117.1.94445 WP_000729117.1.94446 WP_000729117.1.94468 WP_000729117.1.94475 WP_000729117.1.94497 WP_000729117.1.94507 WP_000729117.1.94516 WP_000729117.1.94523 WP_000729117.1.94542 WP_000729117.1.94544 WP_000729117.1.94548 WP_000729117.1.9457 WP_000729117.1.94578 WP_000729117.1.94580 WP_000729117.1.94589 WP_000729117.1.94626 WP_000729117.1.94646 WP_000729117.1.94653 WP_000729117.1.94676 WP_000729117.1.94686 WP_000729117.1.94690 WP_000729117.1.94692 WP_000729117.1.94695 WP_000729117.1.94704 WP_000729117.1.94738 WP_000729117.1.94739 WP_000729117.1.9474 WP_000729117.1.94753 WP_000729117.1.94754 WP_000729117.1.94764 WP_000729117.1.94787 WP_000729117.1.94790 WP_000729117.1.948 WP_000729117.1.94801 WP_000729117.1.94806 WP_000729117.1.94808 WP_000729117.1.94822 WP_000729117.1.94823 WP_000729117.1.94836 WP_000729117.1.94841 WP_000729117.1.94847 WP_000729117.1.94877 WP_000729117.1.94880 WP_000729117.1.94889 WP_000729117.1.9489 WP_000729117.1.94892 WP_000729117.1.94898 WP_000729117.1.949 WP_000729117.1.94903 WP_000729117.1.9491 WP_000729117.1.94927 WP_000729117.1.94934 WP_000729117.1.94938 WP_000729117.1.94955 WP_000729117.1.94963 WP_000729117.1.94991 WP_000729117.1.94993 WP_000729117.1.94997 WP_000729117.1.95005 WP_000729117.1.95011 WP_000729117.1.95022 WP_000729117.1.95028 WP_000729117.1.95035 WP_000729117.1.95036 WP_000729117.1.95037 WP_000729117.1.95080 WP_000729117.1.95084 WP_000729117.1.95105 WP_000729117.1.95129 WP_000729117.1.9513 WP_000729117.1.95161 WP_000729117.1.95198 WP_000729117.1.95233 WP_000729117.1.95243 WP_000729117.1.95244 WP_000729117.1.95254 WP_000729117.1.95275 WP_000729117.1.95310 WP_000729117.1.95329 WP_000729117.1.95332 WP_000729117.1.95364 WP_000729117.1.95366 WP_000729117.1.95368 WP_000729117.1.95378 WP_000729117.1.95381 WP_000729117.1.95390 WP_000729117.1.95395 WP_000729117.1.95398 WP_000729117.1.95400 WP_000729117.1.95403 WP_000729117.1.95424 WP_000729117.1.95428 WP_000729117.1.95431 WP_000729117.1.95438 WP_000729117.1.95449 WP_000729117.1.95490 WP_000729117.1.95518 WP_000729117.1.95521 WP_000729117.1.95563 WP_000729117.1.9559 WP_000729117.1.95595 WP_000729117.1.95596 WP_000729117.1.95604 WP_000729117.1.95611 WP_000729117.1.95628 WP_000729117.1.95634 WP_000729117.1.95655 WP_000729117.1.9566 WP_000729117.1.95666 WP_000729117.1.95680 WP_000729117.1.95712 WP_000729117.1.95756 WP_000729117.1.95759 WP_000729117.1.95771 WP_000729117.1.95783 WP_000729117.1.95784 WP_000729117.1.95800 WP_000729117.1.95801 WP_000729117.1.95821 WP_000729117.1.95824 WP_000729117.1.95834 WP_000729117.1.95835 WP_000729117.1.95846 WP_000729117.1.95849 WP_000729117.1.95858 WP_000729117.1.95861 WP_000729117.1.95865 WP_000729117.1.95869 WP_000729117.1.95916 WP_000729117.1.95919 WP_000729117.1.95929 WP_000729117.1.95931 WP_000729117.1.95932 WP_000729117.1.960 WP_000729117.1.96015 WP_000729117.1.96032 WP_000729117.1.96053 WP_000729117.1.96059 WP_000729117.1.96066 WP_000729117.1.96086 WP_000729117.1.96097 WP_000729117.1.96110 WP_000729117.1.96114 WP_000729117.1.96128 WP_000729117.1.96143 WP_000729117.1.96145 WP_000729117.1.9616 WP_000729117.1.96177 WP_000729117.1.96222 WP_000729117.1.96223 WP_000729117.1.96229 WP_000729117.1.96253 WP_000729117.1.96263 WP_000729117.1.96278 WP_000729117.1.96279 WP_000729117.1.96281 WP_000729117.1.96290 WP_000729117.1.96293 WP_000729117.1.96299 WP_000729117.1.96303 WP_000729117.1.9631 WP_000729117.1.96339 WP_000729117.1.96341 WP_000729117.1.96378 WP_000729117.1.96392 WP_000729117.1.96394 WP_000729117.1.9641 WP_000729117.1.96417 WP_000729117.1.96420 WP_000729117.1.96425 WP_000729117.1.96450 WP_000729117.1.96457 WP_000729117.1.96478 WP_000729117.1.96479 WP_000729117.1.96480 WP_000729117.1.96484 WP_000729117.1.96494 WP_000729117.1.965 WP_000729117.1.96519 WP_000729117.1.96541 WP_000729117.1.96558 WP_000729117.1.96562 WP_000729117.1.9657 WP_000729117.1.96585 WP_000729117.1.96608 WP_000729117.1.96609 WP_000729117.1.9661 WP_000729117.1.96617 WP_000729117.1.96633 WP_000729117.1.96650 WP_000729117.1.96659 WP_000729117.1.96676 WP_000729117.1.9668 WP_000729117.1.96680 WP_000729117.1.96683 WP_000729117.1.96695 WP_000729117.1.96701 WP_000729117.1.9671 WP_000729117.1.96725 WP_000729117.1.96743 WP_000729117.1.96753 WP_000729117.1.96759 WP_000729117.1.96769 WP_000729117.1.96779 WP_000729117.1.96797 WP_000729117.1.96817 WP_000729117.1.9682 WP_000729117.1.96820 WP_000729117.1.96850 WP_000729117.1.96864 WP_000729117.1.96894 WP_000729117.1.9690 WP_000729117.1.96907 WP_000729117.1.9691 WP_000729117.1.96932 WP_000729117.1.96936 WP_000729117.1.96944 WP_000729117.1.96971 WP_000729117.1.96984 WP_000729117.1.96989 WP_000729117.1.97011 WP_000729117.1.97027 WP_000729117.1.97049 WP_000729117.1.97059 WP_000729117.1.9708 WP_000729117.1.97119 WP_000729117.1.97123 WP_000729117.1.97147 WP_000729117.1.97170 WP_000729117.1.97193 WP_000729117.1.97195 WP_000729117.1.97200 WP_000729117.1.97226 WP_000729117.1.9723 WP_000729117.1.97231 WP_000729117.1.97238 WP_000729117.1.97247 WP_000729117.1.97248 WP_000729117.1.97269 WP_000729117.1.97279 WP_000729117.1.97282 WP_000729117.1.9729 WP_000729117.1.97292 WP_000729117.1.97344 WP_000729117.1.97351 WP_000729117.1.97356 WP_000729117.1.97360 WP_000729117.1.97361 WP_000729117.1.97379 WP_000729117.1.97387 WP_000729117.1.9740 WP_000729117.1.97402 WP_000729117.1.97418 WP_000729117.1.97421 WP_000729117.1.97434 WP_000729117.1.97437 WP_000729117.1.97439 WP_000729117.1.97459 WP_000729117.1.97464 WP_000729117.1.9747 WP_000729117.1.97502 WP_000729117.1.97525 WP_000729117.1.97527 WP_000729117.1.97538 WP_000729117.1.97544 WP_000729117.1.97549 WP_000729117.1.97560 WP_000729117.1.97571 WP_000729117.1.97619 WP_000729117.1.97632 WP_000729117.1.97654 WP_000729117.1.97667 WP_000729117.1.97675 WP_000729117.1.97677 WP_000729117.1.97685 WP_000729117.1.9770 WP_000729117.1.97705 WP_000729117.1.97711 WP_000729117.1.97770 WP_000729117.1.97775 WP_000729117.1.97778 WP_000729117.1.97789 WP_000729117.1.97798 WP_000729117.1.978 WP_000729117.1.97802 WP_000729117.1.97815 WP_000729117.1.97822 WP_000729117.1.97823 WP_000729117.1.97825 WP_000729117.1.97871 WP_000729117.1.97890 WP_000729117.1.97895 WP_000729117.1.97919 WP_000729117.1.97930 WP_000729117.1.97932 WP_000729117.1.97937 WP_000729117.1.97962 WP_000729117.1.97996 WP_000729117.1.98000 WP_000729117.1.98005 WP_000729117.1.98012 WP_000729117.1.98026 WP_000729117.1.9803 WP_000729117.1.98046 WP_000729117.1.98082 WP_000729117.1.98083 WP_000729117.1.981 WP_000729117.1.98102 WP_000729117.1.98115 WP_000729117.1.98139 WP_000729117.1.98155 WP_000729117.1.9816 WP_000729117.1.98167 WP_000729117.1.9817 WP_000729117.1.98176 WP_000729117.1.98187 WP_000729117.1.98202 WP_000729117.1.98205 WP_000729117.1.98208 WP_000729117.1.98220 WP_000729117.1.98232 WP_000729117.1.98235 WP_000729117.1.98239 WP_000729117.1.98241 WP_000729117.1.98244 WP_000729117.1.98251 WP_000729117.1.98279 WP_000729117.1.98284 WP_000729117.1.98292 WP_000729117.1.98294 WP_000729117.1.98301 WP_000729117.1.98312 WP_000729117.1.98323 WP_000729117.1.98355 WP_000729117.1.98357 WP_000729117.1.98384 WP_000729117.1.98400 WP_000729117.1.98404 WP_000729117.1.98424 WP_000729117.1.98429 WP_000729117.1.9844 WP_000729117.1.98451 WP_000729117.1.98466 WP_000729117.1.98477 WP_000729117.1.98480 WP_000729117.1.98498 WP_000729117.1.98543 WP_000729117.1.98549 WP_000729117.1.98569 WP_000729117.1.98578 WP_000729117.1.9858 WP_000729117.1.98587 WP_000729117.1.98603 WP_000729117.1.98614 WP_000729117.1.98626 WP_000729117.1.98628 WP_000729117.1.98633 WP_000729117.1.9864 WP_000729117.1.98641 WP_000729117.1.98654 WP_000729117.1.98665 WP_000729117.1.98668 WP_000729117.1.98683 WP_000729117.1.98702 WP_000729117.1.98727 WP_000729117.1.98757 WP_000729117.1.98775 WP_000729117.1.98784 WP_000729117.1.9883 WP_000729117.1.98849 WP_000729117.1.98875 WP_000729117.1.98886 WP_000729117.1.98908 WP_000729117.1.98920 WP_000729117.1.98976 WP_000729117.1.98988 WP_000729117.1.99006 WP_000729117.1.99029 WP_000729117.1.99046 WP_000729117.1.99053 WP_000729117.1.99060 WP_000729117.1.9907 WP_000729117.1.99101 WP_000729117.1.99110 WP_000729117.1.99119 WP_000729117.1.99168 WP_000729117.1.99182 WP_000729117.1.99209 WP_000729117.1.99234 WP_000729117.1.99246 WP_000729117.1.99265 WP_000729117.1.99289 WP_000729117.1.99292 WP_000729117.1.99295 WP_000729117.1.9930 WP_000729117.1.99302 WP_000729117.1.99304 WP_000729117.1.99307 WP_000729117.1.99310 WP_000729117.1.99334 WP_000729117.1.99345 WP_000729117.1.99349 WP_000729117.1.9935 WP_000729117.1.99361 WP_000729117.1.99366 WP_000729117.1.99392 WP_000729117.1.9940 WP_000729117.1.99400 WP_000729117.1.99401 WP_000729117.1.99427 WP_000729117.1.99446 WP_000729117.1.99453 WP_000729117.1.99458 WP_000729117.1.99475 WP_000729117.1.99486 WP_000729117.1.99487 WP_000729117.1.99498 WP_000729117.1.9950 WP_000729117.1.99501 WP_000729117.1.99511 WP_000729117.1.99534 WP_000729117.1.99549 WP_000729117.1.99562 WP_000729117.1.99571 WP_000729117.1.99592 WP_000729117.1.99602 WP_000729117.1.99603 WP_000729117.1.99619 WP_000729117.1.99632 WP_000729117.1.99641 WP_000729117.1.99666 WP_000729117.1.99692 WP_000729117.1.99694 WP_000729117.1.99698 WP_000729117.1.99734 WP_000729117.1.99771 WP_000729117.1.99774 WP_000729117.1.99791 WP_000729117.1.99804 WP_000729117.1.99827 WP_000729117.1.99869 WP_000729117.1.99874 WP_000729117.1.99891 WP_000729117.1.99892 WP_000729117.1.99912 WP_000729117.1.99929 WP_000729117.1.99986 YP_002410472.1.10275 YP_002415277.1.14968 YP_006122556.1.29421 YP_006781241.1.12065 YP_405822.1.10455 gi|443615658|ref|YP_007379514.1| gi|386641821|ref|YP_006108619.1| gi|238903251|ref|YP_002929047.1| gi|26251035|ref|NP_757075.1| gi|387610029|ref|YP_006098885.1| gi|260846975|ref|YP_003224753.1| gi|384545820|ref|YP_005729884.1| gi|387614913|ref|YP_006118029.1| gi|222158911|ref|YP_002559050.1| gi|387832084|ref|YP_003352021.1| gi|386627109|ref|YP_006146837.1| 198214.SF4297 198215.S4564 199310.c5227 300267.SDY_4449 300268.SBO_4313 300269.SSON_4326 316385.ECDH10B_4336 316407.groL 331111.EcE24377A_4698 331112.EcHS_A4384 344609.SbBS512_E4672 364106.UTI89_C4741 373384.SFV_4299 386585.ECs5124 405955.APECO1_2246 409438.ECSE_4442 413997.ECB_04013 439855.EcSMS35_4612 444450.ECH74115_5659 469008.ECBD_3888 481805.EcolC_3869 511145.b4143 544404.ECSP_5243 573235.ECO26_5309 574521.E2348C_4469 585034.ECIAI1_4376 585035.ECS88_4729 585055.EC55989_4698 585056.ECUMN_4678 585057.ECIAI39_4608 585395.ECO103_4938 585397.ECED1_4931 595496.BWG_3856 gi|383181473|ref|YP_005459478.1| gi|407484091|ref|YP_006781241.1| gi|218561303|ref|YP_002394216.1| gi|24115498|ref|NP_710008.1| gi|16131968|ref|NP_418567.1| gi|544578783|ref|YP_008574307.1| gi|170684024|ref|YP_001746539.1| gi|218692481|ref|YP_002400693.1| gi|387509603|ref|YP_006161859.1| gi|544392568|ref|YP_008567361.1| gi|388480091|ref|YP_492286.1| gi|74314631|ref|YP_313050.1| gi|386621901|ref|YP_006141481.1| gi|218702843|ref|YP_002410472.1| gi|407467190|ref|YP_006786368.1| gi|386637072|ref|YP_006156791.1| gi|387885367|ref|YP_006315669.1| gi|82779473|ref|YP_405822.1| gi|386602207|ref|YP_006103713.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]