SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|218554302|ref|YP_002387215.1| from Escherichia coli IAI1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|218554302|ref|YP_002387215.1|
Domain Number 1 Region: 14-113
Classification Level Classification E-value
Superfamily Enzyme IIa from lactose specific PTS, IIa-lac 5.36e-34
Family Enzyme IIa from lactose specific PTS, IIa-lac 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|218554302|ref|YP_002387215.1|
Sequence length 116
Comment PTS system N,N'-diacetylchitobiose-specific transporter subunit IIA [Escherichia coli IAI1]
Sequence
MMDLDNIPDTQTEAEELEEVVMGLIINSGQARSLAYAALKQAKQGDFAAAKAMMDQSRMA
LNEAHLVQTKLIEGDAGEGKMKVSLVLVHAQDHLMTSMLARELITELIELHEKLKA
Download sequence
Identical sequences A0A017IH12 A0A024KW58 A0A025CRC0 A0A026UEC8 A0A027TWG4 A0A062YCX2 A0A064THK9 A0A069XME3 A0A070EVE6 A0A070T448 A0A080J2K4 A0A0A8UCK5 A0A0E0V5H2 A0A0E1LY68 A0A0E1ST83 A0A0E2U5Z7 A0A0F6C525 A0A0F6F783 A0A0G3K4K7 A0A0H3EKM2 A0A0H3MFY5 A0A0H3PLY2 A0A0I2HUN0 A0A0M7NPA9 A0A125X3S2 A0A127GKK6 A0A140N939 A0A142H3H6 A0A181WQK9 A0A192C6M2 A0A1S9ITK2 A0A1S9KGA7 A0A1W2MN69 A0A1X3I6R8 A0A1X3IMA9 A0A1X3IYW8 A0A1X3JG29 A0A1X3KS85 A0A1X3L3B3 A0A1X3LK04 A0A1X3LYJ7 A0A1Z3V6B8 A0A226K8Y4 A0A2D0NR38 A7ZMK3 B1LDZ5 B6IBF6 B7USB7 C3T7G7 C8U9Z9 C8UBJ0 D3GVE9 D3QUS9 D6HXL7 D6IB49 D8AB34 E0IXF9 E1IKN6 E3PNC0 E3XNU9 E7SVW2 E9TM47 E9XJB0 F4NFD0 F4SYW2 F4TF60 F5NUN9 G0F572 H4IBL4 H4ISH5 H4J8S2 H4KHK7 H4LCH0 I0VMK8 I2ST64 I2UIN4 I2W6L7 I2WU86 I2XDU6 I4SFF8 I6BT49 I6H4F9 J7RTQ7 K4W795 L2V1T4 L3CAG8 L3P547 L3QK53 L4J8L0 L4VIT9 M9GCT4 P69791 P69792 P69793 P69794 Q3Z283 R8YSG1 S0TN95 S0WKZ9 S0YA51 S0YUE1 S1F7Y1 S1PB49 T6HLY7 T6MBQ0 T8K6S9 T9ADC5 T9CZT7 T9SCX0 U9XYS6 U9Z2V7 U9ZJQ9 V0SB22 V0W8J2 V0ZEG8 V2R1T9 V6FSQ1 V8FAD5 V8KCW9 W1AYC0 W1F9L6 W9AG10
gi|387617075|ref|YP_006120097.1| gi|254161795|ref|YP_003044903.1| gi|218554302|ref|YP_002387215.1| gi|387506980|ref|YP_006159236.1| gi|260868261|ref|YP_003234663.1| gi|386639263|ref|YP_006106061.1| gi|386704535|ref|YP_006168382.1| gi|15831696|ref|NP_310469.1| gi|253773310|ref|YP_003036141.1| gi|15802147|ref|NP_288169.1| gi|378712827|ref|YP_005277720.1| gi|251785184|ref|YP_002999488.1| gi|544390379|ref|YP_008564911.1| gi|383178146|ref|YP_005456151.1| gi|556551728|ref|YP_008721877.1| gi|387829650|ref|YP_003349587.1| gi|260844086|ref|YP_003221864.1| gi|471333577|ref|YP_007557054.1| gi|387612222|ref|YP_006115338.1| gi|30062996|ref|NP_837167.1| gi|378712827|ref|YP_005277720.1| gi|16129690|ref|NP_416250.1| gi|388477809|ref|YP_489997.1| gi|387621454|ref|YP_006129081.1| gi|443617819|ref|YP_007381675.1| gi|386624358|ref|YP_006144086.1| gi|218699697|ref|YP_002407326.1| gi|251785184|ref|YP_002999488.1| gi|222156484|ref|YP_002556623.1| gi|74311945|ref|YP_310364.1| gi|387607355|ref|YP_006096211.1| 155864.Z2766 198214.SF1490 198215.S1607 199310.c2135 300269.SSON_1422 316385.ECDH10B_1874 316407.chbA 331111.EcE24377A_1957 362663.ECP_1682 386585.ECs2442 409438.ECSE_1906 413997.ECB_01705 439855.EcSMS35_1455 469008.ECBD_1909 511145.b1736 544404.ECSP_2304 574521.E2348C_1864 585034.ECIAI1_1796 585057.ECIAI39_1318 585395.ECO103_1929 585396.ECO111_2247 595496.BWG_1549 gi|26247989|ref|NP_754029.1| gi|387882839|ref|YP_006313141.1| gi|386634349|ref|YP_006154068.1| gi|386709592|ref|YP_006173313.1| gi|386709592|ref|YP_006173313.1| gi|386629429|ref|YP_006149149.1| NP_310469.1.58667 NP_416250.1.90541 NP_707375.2.23235 WP_000968919.1.1000 WP_000968919.1.10001 WP_000968919.1.100014 WP_000968919.1.100044 WP_000968919.1.100052 WP_000968919.1.100063 WP_000968919.1.100066 WP_000968919.1.100073 WP_000968919.1.100085 WP_000968919.1.10010 WP_000968919.1.100111 WP_000968919.1.100135 WP_000968919.1.100138 WP_000968919.1.100151 WP_000968919.1.100185 WP_000968919.1.100220 WP_000968919.1.100227 WP_000968919.1.100251 WP_000968919.1.100252 WP_000968919.1.100281 WP_000968919.1.100283 WP_000968919.1.100285 WP_000968919.1.100299 WP_000968919.1.100302 WP_000968919.1.100304 WP_000968919.1.100306 WP_000968919.1.100315 WP_000968919.1.10034 WP_000968919.1.100389 WP_000968919.1.100425 WP_000968919.1.100441 WP_000968919.1.100444 WP_000968919.1.100448 WP_000968919.1.100451 WP_000968919.1.100474 WP_000968919.1.10048 WP_000968919.1.100487 WP_000968919.1.100496 WP_000968919.1.100508 WP_000968919.1.10051 WP_000968919.1.100531 WP_000968919.1.100554 WP_000968919.1.100571 WP_000968919.1.100573 WP_000968919.1.100614 WP_000968919.1.100667 WP_000968919.1.10067 WP_000968919.1.10068 WP_000968919.1.100685 WP_000968919.1.100725 WP_000968919.1.100752 WP_000968919.1.100753 WP_000968919.1.100758 WP_000968919.1.100778 WP_000968919.1.100796 WP_000968919.1.100803 WP_000968919.1.100824 WP_000968919.1.100851 WP_000968919.1.100852 WP_000968919.1.10086 WP_000968919.1.100867 WP_000968919.1.100868 WP_000968919.1.100916 WP_000968919.1.100925 WP_000968919.1.100928 WP_000968919.1.100933 WP_000968919.1.100950 WP_000968919.1.100959 WP_000968919.1.100966 WP_000968919.1.101033 WP_000968919.1.101052 WP_000968919.1.101087 WP_000968919.1.101096 WP_000968919.1.101102 WP_000968919.1.101105 WP_000968919.1.101110 WP_000968919.1.101121 WP_000968919.1.101148 WP_000968919.1.101152 WP_000968919.1.101158 WP_000968919.1.101166 WP_000968919.1.101175 WP_000968919.1.101186 WP_000968919.1.101206 WP_000968919.1.101214 WP_000968919.1.101255 WP_000968919.1.101257 WP_000968919.1.10126 WP_000968919.1.101282 WP_000968919.1.101289 WP_000968919.1.101293 WP_000968919.1.10131 WP_000968919.1.101313 WP_000968919.1.10138 WP_000968919.1.101399 WP_000968919.1.101418 WP_000968919.1.101423 WP_000968919.1.101429 WP_000968919.1.101430 WP_000968919.1.101439 WP_000968919.1.101468 WP_000968919.1.101486 WP_000968919.1.101518 WP_000968919.1.101522 WP_000968919.1.10154 WP_000968919.1.101545 WP_000968919.1.101583 WP_000968919.1.101586 WP_000968919.1.101594 WP_000968919.1.101628 WP_000968919.1.101630 WP_000968919.1.101651 WP_000968919.1.101654 WP_000968919.1.101667 WP_000968919.1.101686 WP_000968919.1.101693 WP_000968919.1.101694 WP_000968919.1.101700 WP_000968919.1.101727 WP_000968919.1.10173 WP_000968919.1.101737 WP_000968919.1.101747 WP_000968919.1.101777 WP_000968919.1.101786 WP_000968919.1.10181 WP_000968919.1.101822 WP_000968919.1.10184 WP_000968919.1.101855 WP_000968919.1.101865 WP_000968919.1.10187 WP_000968919.1.10188 WP_000968919.1.101887 WP_000968919.1.101889 WP_000968919.1.10190 WP_000968919.1.101900 WP_000968919.1.101908 WP_000968919.1.101932 WP_000968919.1.101937 WP_000968919.1.101940 WP_000968919.1.101942 WP_000968919.1.101947 WP_000968919.1.101948 WP_000968919.1.101952 WP_000968919.1.101964 WP_000968919.1.101969 WP_000968919.1.101977 WP_000968919.1.101984 WP_000968919.1.101987 WP_000968919.1.102021 WP_000968919.1.102036 WP_000968919.1.10206 WP_000968919.1.102076 WP_000968919.1.102093 WP_000968919.1.102094 WP_000968919.1.102104 WP_000968919.1.102106 WP_000968919.1.102122 WP_000968919.1.102139 WP_000968919.1.10222 WP_000968919.1.10226 WP_000968919.1.10233 WP_000968919.1.10235 WP_000968919.1.10252 WP_000968919.1.10273 WP_000968919.1.10304 WP_000968919.1.10329 WP_000968919.1.10335 WP_000968919.1.10348 WP_000968919.1.10352 WP_000968919.1.10361 WP_000968919.1.10379 WP_000968919.1.1040 WP_000968919.1.10400 WP_000968919.1.10417 WP_000968919.1.10476 WP_000968919.1.10491 WP_000968919.1.10496 WP_000968919.1.10508 WP_000968919.1.10524 WP_000968919.1.10525 WP_000968919.1.10569 WP_000968919.1.10573 WP_000968919.1.10576 WP_000968919.1.1058 WP_000968919.1.10605 WP_000968919.1.10628 WP_000968919.1.10651 WP_000968919.1.10705 WP_000968919.1.10715 WP_000968919.1.10729 WP_000968919.1.1073 WP_000968919.1.1074 WP_000968919.1.10748 WP_000968919.1.10761 WP_000968919.1.10771 WP_000968919.1.10786 WP_000968919.1.10787 WP_000968919.1.10809 WP_000968919.1.10824 WP_000968919.1.10833 WP_000968919.1.10842 WP_000968919.1.10849 WP_000968919.1.10862 WP_000968919.1.10869 WP_000968919.1.10922 WP_000968919.1.10940 WP_000968919.1.10970 WP_000968919.1.10988 WP_000968919.1.10989 WP_000968919.1.10994 WP_000968919.1.10995 WP_000968919.1.11006 WP_000968919.1.11032 WP_000968919.1.11047 WP_000968919.1.11052 WP_000968919.1.11068 WP_000968919.1.11071 WP_000968919.1.11091 WP_000968919.1.1111 WP_000968919.1.11113 WP_000968919.1.11118 WP_000968919.1.1113 WP_000968919.1.11133 WP_000968919.1.112 WP_000968919.1.11240 WP_000968919.1.11241 WP_000968919.1.11251 WP_000968919.1.11265 WP_000968919.1.11272 WP_000968919.1.11285 WP_000968919.1.11301 WP_000968919.1.11315 WP_000968919.1.11323 WP_000968919.1.11408 WP_000968919.1.11411 WP_000968919.1.11420 WP_000968919.1.11436 WP_000968919.1.11440 WP_000968919.1.11452 WP_000968919.1.11467 WP_000968919.1.11499 WP_000968919.1.11524 WP_000968919.1.11542 WP_000968919.1.11575 WP_000968919.1.11578 WP_000968919.1.11595 WP_000968919.1.11607 WP_000968919.1.11608 WP_000968919.1.11612 WP_000968919.1.11616 WP_000968919.1.11645 WP_000968919.1.11671 WP_000968919.1.11673 WP_000968919.1.1168 WP_000968919.1.11690 WP_000968919.1.11699 WP_000968919.1.11748 WP_000968919.1.1176 WP_000968919.1.11762 WP_000968919.1.11844 WP_000968919.1.1186 WP_000968919.1.11912 WP_000968919.1.11955 WP_000968919.1.11981 WP_000968919.1.11982 WP_000968919.1.11985 WP_000968919.1.12000 WP_000968919.1.12030 WP_000968919.1.12050 WP_000968919.1.12051 WP_000968919.1.12060 WP_000968919.1.12088 WP_000968919.1.12095 WP_000968919.1.12111 WP_000968919.1.12112 WP_000968919.1.1212 WP_000968919.1.12151 WP_000968919.1.12157 WP_000968919.1.12174 WP_000968919.1.1218 WP_000968919.1.12204 WP_000968919.1.12230 WP_000968919.1.12259 WP_000968919.1.12268 WP_000968919.1.12279 WP_000968919.1.12292 WP_000968919.1.12295 WP_000968919.1.12305 WP_000968919.1.12319 WP_000968919.1.12320 WP_000968919.1.12342 WP_000968919.1.12352 WP_000968919.1.12415 WP_000968919.1.1242 WP_000968919.1.12426 WP_000968919.1.12458 WP_000968919.1.12459 WP_000968919.1.12468 WP_000968919.1.12478 WP_000968919.1.12542 WP_000968919.1.12552 WP_000968919.1.12558 WP_000968919.1.12566 WP_000968919.1.12582 WP_000968919.1.12594 WP_000968919.1.12623 WP_000968919.1.12646 WP_000968919.1.12675 WP_000968919.1.12680 WP_000968919.1.12693 WP_000968919.1.127 WP_000968919.1.12709 WP_000968919.1.12743 WP_000968919.1.1275 WP_000968919.1.12756 WP_000968919.1.12763 WP_000968919.1.12766 WP_000968919.1.12775 WP_000968919.1.1278 WP_000968919.1.12781 WP_000968919.1.1280 WP_000968919.1.12826 WP_000968919.1.12830 WP_000968919.1.12831 WP_000968919.1.12876 WP_000968919.1.12893 WP_000968919.1.12911 WP_000968919.1.12914 WP_000968919.1.12915 WP_000968919.1.12917 WP_000968919.1.12944 WP_000968919.1.1295 WP_000968919.1.12956 WP_000968919.1.12965 WP_000968919.1.12976 WP_000968919.1.12979 WP_000968919.1.12987 WP_000968919.1.12991 WP_000968919.1.13002 WP_000968919.1.13031 WP_000968919.1.13060 WP_000968919.1.13074 WP_000968919.1.1308 WP_000968919.1.13117 WP_000968919.1.1312 WP_000968919.1.13136 WP_000968919.1.1314 WP_000968919.1.1315 WP_000968919.1.13157 WP_000968919.1.13162 WP_000968919.1.13176 WP_000968919.1.13217 WP_000968919.1.13223 WP_000968919.1.13239 WP_000968919.1.13258 WP_000968919.1.13272 WP_000968919.1.13278 WP_000968919.1.13281 WP_000968919.1.13290 WP_000968919.1.13301 WP_000968919.1.13332 WP_000968919.1.13333 WP_000968919.1.13348 WP_000968919.1.1335 WP_000968919.1.13383 WP_000968919.1.13409 WP_000968919.1.13411 WP_000968919.1.1343 WP_000968919.1.13430 WP_000968919.1.13442 WP_000968919.1.1345 WP_000968919.1.13451 WP_000968919.1.13481 WP_000968919.1.13492 WP_000968919.1.13495 WP_000968919.1.13525 WP_000968919.1.13566 WP_000968919.1.13585 WP_000968919.1.13589 WP_000968919.1.13600 WP_000968919.1.13601 WP_000968919.1.13608 WP_000968919.1.13618 WP_000968919.1.13624 WP_000968919.1.13626 WP_000968919.1.13672 WP_000968919.1.13740 WP_000968919.1.13778 WP_000968919.1.13791 WP_000968919.1.13877 WP_000968919.1.13881 WP_000968919.1.13891 WP_000968919.1.13924 WP_000968919.1.13934 WP_000968919.1.13936 WP_000968919.1.13939 WP_000968919.1.13944 WP_000968919.1.13949 WP_000968919.1.13974 WP_000968919.1.13981 WP_000968919.1.14023 WP_000968919.1.14030 WP_000968919.1.14062 WP_000968919.1.14094 WP_000968919.1.14110 WP_000968919.1.14127 WP_000968919.1.14144 WP_000968919.1.14154 WP_000968919.1.14164 WP_000968919.1.1419 WP_000968919.1.142 WP_000968919.1.14245 WP_000968919.1.14277 WP_000968919.1.14299 WP_000968919.1.14304 WP_000968919.1.14322 WP_000968919.1.14346 WP_000968919.1.14371 WP_000968919.1.1438 WP_000968919.1.14389 WP_000968919.1.1439 WP_000968919.1.14417 WP_000968919.1.14432 WP_000968919.1.14445 WP_000968919.1.14451 WP_000968919.1.14453 WP_000968919.1.14468 WP_000968919.1.14493 WP_000968919.1.14499 WP_000968919.1.14501 WP_000968919.1.14529 WP_000968919.1.14536 WP_000968919.1.14538 WP_000968919.1.14581 WP_000968919.1.14582 WP_000968919.1.14601 WP_000968919.1.14605 WP_000968919.1.14607 WP_000968919.1.1461 WP_000968919.1.14621 WP_000968919.1.14648 WP_000968919.1.14661 WP_000968919.1.14672 WP_000968919.1.14687 WP_000968919.1.1470 WP_000968919.1.14711 WP_000968919.1.14712 WP_000968919.1.14748 WP_000968919.1.14749 WP_000968919.1.14807 WP_000968919.1.14811 WP_000968919.1.14833 WP_000968919.1.1486 WP_000968919.1.14861 WP_000968919.1.14871 WP_000968919.1.14879 WP_000968919.1.14914 WP_000968919.1.14935 WP_000968919.1.14946 WP_000968919.1.14958 WP_000968919.1.14963 WP_000968919.1.14965 WP_000968919.1.14977 WP_000968919.1.14992 WP_000968919.1.14993 WP_000968919.1.15007 WP_000968919.1.15020 WP_000968919.1.15041 WP_000968919.1.1508 WP_000968919.1.15087 WP_000968919.1.1512 WP_000968919.1.15121 WP_000968919.1.15138 WP_000968919.1.15148 WP_000968919.1.15191 WP_000968919.1.15193 WP_000968919.1.15207 WP_000968919.1.15245 WP_000968919.1.15252 WP_000968919.1.15259 WP_000968919.1.15270 WP_000968919.1.15274 WP_000968919.1.15282 WP_000968919.1.15287 WP_000968919.1.15290 WP_000968919.1.15300 WP_000968919.1.15304 WP_000968919.1.15335 WP_000968919.1.15347 WP_000968919.1.15356 WP_000968919.1.15416 WP_000968919.1.15420 WP_000968919.1.1543 WP_000968919.1.15444 WP_000968919.1.15453 WP_000968919.1.15469 WP_000968919.1.15496 WP_000968919.1.1550 WP_000968919.1.15503 WP_000968919.1.15521 WP_000968919.1.15527 WP_000968919.1.15528 WP_000968919.1.15538 WP_000968919.1.15565 WP_000968919.1.15576 WP_000968919.1.15583 WP_000968919.1.1559 WP_000968919.1.1561 WP_000968919.1.15620 WP_000968919.1.15626 WP_000968919.1.15645 WP_000968919.1.15654 WP_000968919.1.15702 WP_000968919.1.15707 WP_000968919.1.15731 WP_000968919.1.15740 WP_000968919.1.15747 WP_000968919.1.15752 WP_000968919.1.15762 WP_000968919.1.15767 WP_000968919.1.15771 WP_000968919.1.15782 WP_000968919.1.15791 WP_000968919.1.1580 WP_000968919.1.15809 WP_000968919.1.1582 WP_000968919.1.15855 WP_000968919.1.15863 WP_000968919.1.15869 WP_000968919.1.1588 WP_000968919.1.15894 WP_000968919.1.15906 WP_000968919.1.15945 WP_000968919.1.15983 WP_000968919.1.15990 WP_000968919.1.16010 WP_000968919.1.16015 WP_000968919.1.1604 WP_000968919.1.16042 WP_000968919.1.16067 WP_000968919.1.16075 WP_000968919.1.16086 WP_000968919.1.16087 WP_000968919.1.1609 WP_000968919.1.16102 WP_000968919.1.16111 WP_000968919.1.16131 WP_000968919.1.16133 WP_000968919.1.16171 WP_000968919.1.16179 WP_000968919.1.16183 WP_000968919.1.16188 WP_000968919.1.16194 WP_000968919.1.1621 WP_000968919.1.1622 WP_000968919.1.16222 WP_000968919.1.16270 WP_000968919.1.16272 WP_000968919.1.16294 WP_000968919.1.163 WP_000968919.1.16303 WP_000968919.1.1634 WP_000968919.1.16388 WP_000968919.1.16396 WP_000968919.1.16435 WP_000968919.1.16463 WP_000968919.1.16481 WP_000968919.1.16482 WP_000968919.1.16500 WP_000968919.1.16532 WP_000968919.1.16539 WP_000968919.1.16541 WP_000968919.1.1655 WP_000968919.1.16577 WP_000968919.1.16592 WP_000968919.1.16604 WP_000968919.1.16612 WP_000968919.1.16640 WP_000968919.1.16648 WP_000968919.1.16669 WP_000968919.1.16682 WP_000968919.1.16700 WP_000968919.1.16705 WP_000968919.1.16715 WP_000968919.1.16721 WP_000968919.1.1673 WP_000968919.1.16745 WP_000968919.1.16752 WP_000968919.1.16766 WP_000968919.1.16798 WP_000968919.1.16799 WP_000968919.1.16805 WP_000968919.1.16807 WP_000968919.1.16818 WP_000968919.1.16843 WP_000968919.1.16845 WP_000968919.1.16861 WP_000968919.1.16894 WP_000968919.1.16927 WP_000968919.1.16970 WP_000968919.1.16979 WP_000968919.1.16992 WP_000968919.1.17014 WP_000968919.1.17018 WP_000968919.1.17028 WP_000968919.1.17042 WP_000968919.1.17061 WP_000968919.1.17084 WP_000968919.1.17085 WP_000968919.1.17087 WP_000968919.1.17089 WP_000968919.1.1710 WP_000968919.1.17101 WP_000968919.1.17109 WP_000968919.1.17111 WP_000968919.1.17114 WP_000968919.1.17119 WP_000968919.1.17123 WP_000968919.1.17153 WP_000968919.1.17182 WP_000968919.1.17186 WP_000968919.1.17187 WP_000968919.1.17205 WP_000968919.1.17206 WP_000968919.1.17216 WP_000968919.1.17230 WP_000968919.1.17241 WP_000968919.1.17242 WP_000968919.1.1726 WP_000968919.1.17267 WP_000968919.1.17282 WP_000968919.1.17290 WP_000968919.1.17297 WP_000968919.1.17300 WP_000968919.1.17301 WP_000968919.1.1731 WP_000968919.1.17325 WP_000968919.1.17356 WP_000968919.1.17360 WP_000968919.1.17386 WP_000968919.1.17387 WP_000968919.1.17389 WP_000968919.1.17392 WP_000968919.1.17403 WP_000968919.1.17410 WP_000968919.1.17415 WP_000968919.1.17417 WP_000968919.1.17432 WP_000968919.1.17441 WP_000968919.1.17461 WP_000968919.1.17496 WP_000968919.1.17515 WP_000968919.1.17534 WP_000968919.1.1754 WP_000968919.1.1755 WP_000968919.1.17550 WP_000968919.1.17570 WP_000968919.1.17577 WP_000968919.1.17595 WP_000968919.1.17623 WP_000968919.1.1763 WP_000968919.1.1766 WP_000968919.1.17680 WP_000968919.1.1769 WP_000968919.1.17711 WP_000968919.1.17757 WP_000968919.1.17765 WP_000968919.1.17766 WP_000968919.1.17769 WP_000968919.1.1778 WP_000968919.1.17802 WP_000968919.1.17829 WP_000968919.1.17836 WP_000968919.1.17849 WP_000968919.1.17889 WP_000968919.1.17904 WP_000968919.1.17925 WP_000968919.1.17937 WP_000968919.1.17952 WP_000968919.1.17961 WP_000968919.1.17963 WP_000968919.1.17984 WP_000968919.1.18000 WP_000968919.1.18024 WP_000968919.1.18050 WP_000968919.1.18094 WP_000968919.1.18112 WP_000968919.1.18118 WP_000968919.1.18121 WP_000968919.1.18133 WP_000968919.1.18134 WP_000968919.1.18136 WP_000968919.1.18141 WP_000968919.1.18164 WP_000968919.1.18175 WP_000968919.1.1821 WP_000968919.1.18226 WP_000968919.1.18229 WP_000968919.1.18275 WP_000968919.1.18311 WP_000968919.1.18316 WP_000968919.1.18326 WP_000968919.1.18329 WP_000968919.1.18337 WP_000968919.1.18338 WP_000968919.1.1834 WP_000968919.1.18340 WP_000968919.1.18348 WP_000968919.1.18354 WP_000968919.1.18381 WP_000968919.1.18383 WP_000968919.1.18394 WP_000968919.1.18402 WP_000968919.1.18420 WP_000968919.1.18436 WP_000968919.1.1844 WP_000968919.1.18482 WP_000968919.1.18511 WP_000968919.1.18519 WP_000968919.1.18550 WP_000968919.1.18556 WP_000968919.1.18581 WP_000968919.1.18583 WP_000968919.1.18588 WP_000968919.1.18617 WP_000968919.1.18628 WP_000968919.1.18649 WP_000968919.1.18651 WP_000968919.1.1866 WP_000968919.1.18666 WP_000968919.1.1867 WP_000968919.1.18675 WP_000968919.1.18714 WP_000968919.1.18725 WP_000968919.1.18726 WP_000968919.1.1873 WP_000968919.1.18734 WP_000968919.1.188 WP_000968919.1.18801 WP_000968919.1.18802 WP_000968919.1.18806 WP_000968919.1.1881 WP_000968919.1.18828 WP_000968919.1.18837 WP_000968919.1.18858 WP_000968919.1.18861 WP_000968919.1.18874 WP_000968919.1.18876 WP_000968919.1.18908 WP_000968919.1.18923 WP_000968919.1.18929 WP_000968919.1.18934 WP_000968919.1.18936 WP_000968919.1.1896 WP_000968919.1.18962 WP_000968919.1.18995 WP_000968919.1.19024 WP_000968919.1.1903 WP_000968919.1.19036 WP_000968919.1.19039 WP_000968919.1.1906 WP_000968919.1.19075 WP_000968919.1.19090 WP_000968919.1.191 WP_000968919.1.19100 WP_000968919.1.19113 WP_000968919.1.19122 WP_000968919.1.19135 WP_000968919.1.19140 WP_000968919.1.19148 WP_000968919.1.1915 WP_000968919.1.19150 WP_000968919.1.19153 WP_000968919.1.19171 WP_000968919.1.19194 WP_000968919.1.19205 WP_000968919.1.19206 WP_000968919.1.19245 WP_000968919.1.1925 WP_000968919.1.19277 WP_000968919.1.19297 WP_000968919.1.193 WP_000968919.1.19312 WP_000968919.1.19313 WP_000968919.1.19314 WP_000968919.1.19315 WP_000968919.1.19332 WP_000968919.1.19338 WP_000968919.1.19347 WP_000968919.1.19350 WP_000968919.1.19361 WP_000968919.1.19374 WP_000968919.1.19389 WP_000968919.1.19397 WP_000968919.1.19419 WP_000968919.1.19424 WP_000968919.1.19441 WP_000968919.1.19448 WP_000968919.1.19453 WP_000968919.1.19465 WP_000968919.1.19487 WP_000968919.1.19494 WP_000968919.1.19544 WP_000968919.1.19547 WP_000968919.1.19557 WP_000968919.1.19593 WP_000968919.1.1960 WP_000968919.1.19602 WP_000968919.1.19612 WP_000968919.1.1963 WP_000968919.1.19644 WP_000968919.1.19649 WP_000968919.1.19654 WP_000968919.1.19655 WP_000968919.1.19661 WP_000968919.1.19758 WP_000968919.1.19760 WP_000968919.1.19761 WP_000968919.1.19795 WP_000968919.1.1982 WP_000968919.1.19838 WP_000968919.1.19840 WP_000968919.1.19845 WP_000968919.1.19847 WP_000968919.1.19873 WP_000968919.1.19878 WP_000968919.1.19889 WP_000968919.1.19940 WP_000968919.1.19945 WP_000968919.1.19957 WP_000968919.1.19972 WP_000968919.1.19994 WP_000968919.1.20025 WP_000968919.1.2005 WP_000968919.1.20096 WP_000968919.1.20114 WP_000968919.1.20115 WP_000968919.1.20129 WP_000968919.1.20133 WP_000968919.1.20136 WP_000968919.1.20151 WP_000968919.1.20157 WP_000968919.1.20164 WP_000968919.1.20166 WP_000968919.1.20170 WP_000968919.1.20178 WP_000968919.1.20192 WP_000968919.1.20215 WP_000968919.1.2022 WP_000968919.1.20224 WP_000968919.1.20230 WP_000968919.1.20238 WP_000968919.1.20251 WP_000968919.1.20277 WP_000968919.1.20289 WP_000968919.1.20290 WP_000968919.1.20308 WP_000968919.1.20325 WP_000968919.1.20331 WP_000968919.1.20370 WP_000968919.1.20388 WP_000968919.1.20445 WP_000968919.1.20449 WP_000968919.1.20452 WP_000968919.1.20483 WP_000968919.1.20484 WP_000968919.1.20493 WP_000968919.1.20506 WP_000968919.1.20515 WP_000968919.1.20519 WP_000968919.1.20536 WP_000968919.1.20546 WP_000968919.1.20565 WP_000968919.1.20575 WP_000968919.1.20594 WP_000968919.1.2063 WP_000968919.1.20630 WP_000968919.1.20638 WP_000968919.1.20640 WP_000968919.1.20662 WP_000968919.1.20668 WP_000968919.1.20724 WP_000968919.1.20730 WP_000968919.1.20737 WP_000968919.1.20741 WP_000968919.1.20745 WP_000968919.1.20765 WP_000968919.1.20784 WP_000968919.1.20785 WP_000968919.1.20803 WP_000968919.1.20813 WP_000968919.1.20818 WP_000968919.1.20824 WP_000968919.1.20831 WP_000968919.1.20841 WP_000968919.1.20848 WP_000968919.1.20863 WP_000968919.1.2089 WP_000968919.1.20893 WP_000968919.1.2092 WP_000968919.1.2093 WP_000968919.1.20933 WP_000968919.1.2094 WP_000968919.1.20941 WP_000968919.1.20943 WP_000968919.1.20950 WP_000968919.1.20958 WP_000968919.1.20962 WP_000968919.1.20982 WP_000968919.1.20989 WP_000968919.1.2100 WP_000968919.1.21017 WP_000968919.1.21020 WP_000968919.1.21022 WP_000968919.1.21029 WP_000968919.1.21033 WP_000968919.1.21041 WP_000968919.1.21057 WP_000968919.1.21059 WP_000968919.1.21104 WP_000968919.1.21122 WP_000968919.1.21129 WP_000968919.1.2113 WP_000968919.1.21131 WP_000968919.1.21137 WP_000968919.1.21152 WP_000968919.1.21171 WP_000968919.1.21197 WP_000968919.1.21236 WP_000968919.1.21248 WP_000968919.1.21251 WP_000968919.1.21266 WP_000968919.1.21277 WP_000968919.1.21305 WP_000968919.1.21320 WP_000968919.1.21378 WP_000968919.1.2142 WP_000968919.1.21441 WP_000968919.1.21450 WP_000968919.1.21455 WP_000968919.1.21470 WP_000968919.1.21508 WP_000968919.1.21519 WP_000968919.1.21526 WP_000968919.1.21537 WP_000968919.1.2156 WP_000968919.1.21573 WP_000968919.1.21578 WP_000968919.1.21596 WP_000968919.1.21614 WP_000968919.1.21637 WP_000968919.1.2164 WP_000968919.1.21652 WP_000968919.1.21656 WP_000968919.1.21661 WP_000968919.1.21666 WP_000968919.1.21668 WP_000968919.1.21673 WP_000968919.1.21696 WP_000968919.1.21727 WP_000968919.1.21729 WP_000968919.1.21733 WP_000968919.1.21756 WP_000968919.1.21758 WP_000968919.1.21762 WP_000968919.1.21771 WP_000968919.1.21773 WP_000968919.1.21811 WP_000968919.1.21812 WP_000968919.1.21823 WP_000968919.1.21887 WP_000968919.1.21895 WP_000968919.1.21899 WP_000968919.1.21915 WP_000968919.1.21948 WP_000968919.1.21962 WP_000968919.1.21992 WP_000968919.1.22021 WP_000968919.1.22042 WP_000968919.1.22060 WP_000968919.1.22088 WP_000968919.1.22098 WP_000968919.1.22113 WP_000968919.1.22138 WP_000968919.1.22161 WP_000968919.1.2218 WP_000968919.1.22203 WP_000968919.1.22204 WP_000968919.1.22251 WP_000968919.1.22268 WP_000968919.1.22272 WP_000968919.1.22280 WP_000968919.1.22291 WP_000968919.1.22293 WP_000968919.1.22295 WP_000968919.1.22304 WP_000968919.1.22314 WP_000968919.1.2232 WP_000968919.1.22325 WP_000968919.1.22328 WP_000968919.1.22350 WP_000968919.1.22359 WP_000968919.1.22363 WP_000968919.1.22381 WP_000968919.1.22409 WP_000968919.1.2242 WP_000968919.1.22431 WP_000968919.1.22450 WP_000968919.1.22464 WP_000968919.1.22470 WP_000968919.1.22501 WP_000968919.1.22508 WP_000968919.1.22522 WP_000968919.1.22543 WP_000968919.1.22571 WP_000968919.1.22572 WP_000968919.1.22574 WP_000968919.1.22576 WP_000968919.1.22579 WP_000968919.1.22594 WP_000968919.1.22599 WP_000968919.1.22631 WP_000968919.1.22632 WP_000968919.1.22641 WP_000968919.1.22649 WP_000968919.1.22667 WP_000968919.1.22669 WP_000968919.1.22685 WP_000968919.1.22690 WP_000968919.1.22691 WP_000968919.1.22743 WP_000968919.1.22756 WP_000968919.1.22757 WP_000968919.1.22759 WP_000968919.1.22771 WP_000968919.1.22777 WP_000968919.1.22809 WP_000968919.1.22824 WP_000968919.1.22827 WP_000968919.1.22830 WP_000968919.1.22846 WP_000968919.1.22868 WP_000968919.1.22875 WP_000968919.1.22878 WP_000968919.1.22885 WP_000968919.1.22896 WP_000968919.1.22908 WP_000968919.1.22917 WP_000968919.1.22925 WP_000968919.1.22939 WP_000968919.1.22961 WP_000968919.1.22990 WP_000968919.1.22993 WP_000968919.1.2300 WP_000968919.1.23005 WP_000968919.1.23021 WP_000968919.1.23026 WP_000968919.1.23035 WP_000968919.1.23044 WP_000968919.1.23045 WP_000968919.1.23057 WP_000968919.1.23062 WP_000968919.1.23073 WP_000968919.1.23078 WP_000968919.1.23081 WP_000968919.1.23090 WP_000968919.1.23092 WP_000968919.1.23109 WP_000968919.1.23115 WP_000968919.1.23120 WP_000968919.1.23135 WP_000968919.1.2322 WP_000968919.1.23241 WP_000968919.1.23257 WP_000968919.1.23270 WP_000968919.1.23282 WP_000968919.1.23285 WP_000968919.1.23290 WP_000968919.1.23293 WP_000968919.1.23299 WP_000968919.1.23323 WP_000968919.1.23330 WP_000968919.1.23351 WP_000968919.1.23352 WP_000968919.1.23355 WP_000968919.1.23378 WP_000968919.1.23383 WP_000968919.1.23386 WP_000968919.1.23388 WP_000968919.1.23435 WP_000968919.1.23443 WP_000968919.1.23456 WP_000968919.1.23467 WP_000968919.1.23486 WP_000968919.1.23487 WP_000968919.1.23511 WP_000968919.1.23520 WP_000968919.1.23522 WP_000968919.1.2353 WP_000968919.1.23549 WP_000968919.1.23554 WP_000968919.1.23561 WP_000968919.1.23563 WP_000968919.1.23575 WP_000968919.1.23584 WP_000968919.1.23622 WP_000968919.1.23640 WP_000968919.1.23660 WP_000968919.1.23676 WP_000968919.1.23700 WP_000968919.1.23711 WP_000968919.1.23724 WP_000968919.1.23729 WP_000968919.1.23765 WP_000968919.1.23790 WP_000968919.1.23795 WP_000968919.1.23804 WP_000968919.1.23806 WP_000968919.1.23838 WP_000968919.1.23840 WP_000968919.1.23855 WP_000968919.1.23869 WP_000968919.1.2388 WP_000968919.1.23881 WP_000968919.1.23890 WP_000968919.1.23895 WP_000968919.1.23898 WP_000968919.1.23899 WP_000968919.1.23914 WP_000968919.1.23915 WP_000968919.1.23931 WP_000968919.1.23945 WP_000968919.1.2395 WP_000968919.1.23950 WP_000968919.1.23953 WP_000968919.1.23970 WP_000968919.1.23971 WP_000968919.1.23973 WP_000968919.1.23984 WP_000968919.1.23985 WP_000968919.1.24 WP_000968919.1.24004 WP_000968919.1.24024 WP_000968919.1.24038 WP_000968919.1.24045 WP_000968919.1.24051 WP_000968919.1.24058 WP_000968919.1.24068 WP_000968919.1.24070 WP_000968919.1.24088 WP_000968919.1.24089 WP_000968919.1.24120 WP_000968919.1.24124 WP_000968919.1.24127 WP_000968919.1.24136 WP_000968919.1.24177 WP_000968919.1.2418 WP_000968919.1.24194 WP_000968919.1.24233 WP_000968919.1.24278 WP_000968919.1.2428 WP_000968919.1.24283 WP_000968919.1.24290 WP_000968919.1.24304 WP_000968919.1.24316 WP_000968919.1.2433 WP_000968919.1.24341 WP_000968919.1.24362 WP_000968919.1.2437 WP_000968919.1.24374 WP_000968919.1.24381 WP_000968919.1.24383 WP_000968919.1.24473 WP_000968919.1.24483 WP_000968919.1.24485 WP_000968919.1.2449 WP_000968919.1.24499 WP_000968919.1.24523 WP_000968919.1.24524 WP_000968919.1.24533 WP_000968919.1.24536 WP_000968919.1.24547 WP_000968919.1.2456 WP_000968919.1.24560 WP_000968919.1.24570 WP_000968919.1.24577 WP_000968919.1.24583 WP_000968919.1.24592 WP_000968919.1.24616 WP_000968919.1.24634 WP_000968919.1.24642 WP_000968919.1.24650 WP_000968919.1.2469 WP_000968919.1.24695 WP_000968919.1.24703 WP_000968919.1.24752 WP_000968919.1.24753 WP_000968919.1.24763 WP_000968919.1.24773 WP_000968919.1.24783 WP_000968919.1.2479 WP_000968919.1.24791 WP_000968919.1.24797 WP_000968919.1.24799 WP_000968919.1.24808 WP_000968919.1.24849 WP_000968919.1.24854 WP_000968919.1.24870 WP_000968919.1.24876 WP_000968919.1.24899 WP_000968919.1.24906 WP_000968919.1.24909 WP_000968919.1.24929 WP_000968919.1.24939 WP_000968919.1.24946 WP_000968919.1.24960 WP_000968919.1.24968 WP_000968919.1.24979 WP_000968919.1.24981 WP_000968919.1.24982 WP_000968919.1.24984 WP_000968919.1.25038 WP_000968919.1.25039 WP_000968919.1.2504 WP_000968919.1.25042 WP_000968919.1.25050 WP_000968919.1.25060 WP_000968919.1.25076 WP_000968919.1.25082 WP_000968919.1.25085 WP_000968919.1.25087 WP_000968919.1.25088 WP_000968919.1.2512 WP_000968919.1.25141 WP_000968919.1.25183 WP_000968919.1.25201 WP_000968919.1.25203 WP_000968919.1.25248 WP_000968919.1.25272 WP_000968919.1.25289 WP_000968919.1.25305 WP_000968919.1.2531 WP_000968919.1.25312 WP_000968919.1.25346 WP_000968919.1.2537 WP_000968919.1.25372 WP_000968919.1.25378 WP_000968919.1.25380 WP_000968919.1.254 WP_000968919.1.2540 WP_000968919.1.25403 WP_000968919.1.25414 WP_000968919.1.25420 WP_000968919.1.2543 WP_000968919.1.25480 WP_000968919.1.255 WP_000968919.1.25517 WP_000968919.1.25525 WP_000968919.1.25526 WP_000968919.1.25548 WP_000968919.1.25577 WP_000968919.1.25598 WP_000968919.1.25602 WP_000968919.1.25612 WP_000968919.1.25631 WP_000968919.1.25643 WP_000968919.1.25652 WP_000968919.1.2567 WP_000968919.1.25680 WP_000968919.1.25701 WP_000968919.1.25713 WP_000968919.1.25717 WP_000968919.1.25718 WP_000968919.1.25726 WP_000968919.1.25750 WP_000968919.1.25753 WP_000968919.1.25794 WP_000968919.1.25799 WP_000968919.1.25819 WP_000968919.1.25831 WP_000968919.1.25832 WP_000968919.1.25843 WP_000968919.1.25855 WP_000968919.1.25869 WP_000968919.1.25873 WP_000968919.1.2588 WP_000968919.1.2589 WP_000968919.1.25895 WP_000968919.1.25915 WP_000968919.1.25945 WP_000968919.1.2597 WP_000968919.1.25996 WP_000968919.1.26005 WP_000968919.1.26040 WP_000968919.1.26048 WP_000968919.1.26055 WP_000968919.1.26061 WP_000968919.1.26066 WP_000968919.1.26076 WP_000968919.1.26100 WP_000968919.1.26105 WP_000968919.1.2612 WP_000968919.1.26121 WP_000968919.1.26130 WP_000968919.1.26131 WP_000968919.1.26134 WP_000968919.1.26135 WP_000968919.1.26150 WP_000968919.1.26161 WP_000968919.1.26175 WP_000968919.1.26189 WP_000968919.1.26191 WP_000968919.1.26196 WP_000968919.1.26246 WP_000968919.1.26259 WP_000968919.1.26264 WP_000968919.1.26284 WP_000968919.1.26304 WP_000968919.1.26325 WP_000968919.1.26331 WP_000968919.1.2637 WP_000968919.1.26379 WP_000968919.1.26391 WP_000968919.1.26398 WP_000968919.1.26401 WP_000968919.1.26438 WP_000968919.1.26443 WP_000968919.1.26467 WP_000968919.1.26474 WP_000968919.1.26480 WP_000968919.1.26517 WP_000968919.1.26525 WP_000968919.1.26569 WP_000968919.1.26570 WP_000968919.1.26574 WP_000968919.1.26575 WP_000968919.1.26579 WP_000968919.1.26588 WP_000968919.1.26590 WP_000968919.1.26609 WP_000968919.1.26644 WP_000968919.1.26658 WP_000968919.1.26660 WP_000968919.1.26683 WP_000968919.1.26688 WP_000968919.1.26716 WP_000968919.1.26736 WP_000968919.1.26761 WP_000968919.1.26766 WP_000968919.1.26837 WP_000968919.1.26861 WP_000968919.1.26878 WP_000968919.1.2688 WP_000968919.1.26912 WP_000968919.1.26932 WP_000968919.1.2694 WP_000968919.1.26941 WP_000968919.1.26950 WP_000968919.1.26975 WP_000968919.1.26987 WP_000968919.1.26995 WP_000968919.1.26998 WP_000968919.1.2700 WP_000968919.1.27019 WP_000968919.1.27043 WP_000968919.1.27057 WP_000968919.1.27091 WP_000968919.1.27098 WP_000968919.1.27101 WP_000968919.1.27105 WP_000968919.1.2712 WP_000968919.1.27134 WP_000968919.1.27141 WP_000968919.1.27188 WP_000968919.1.27234 WP_000968919.1.27260 WP_000968919.1.27280 WP_000968919.1.27283 WP_000968919.1.27287 WP_000968919.1.27292 WP_000968919.1.27310 WP_000968919.1.27313 WP_000968919.1.27330 WP_000968919.1.27338 WP_000968919.1.27367 WP_000968919.1.27373 WP_000968919.1.27401 WP_000968919.1.27424 WP_000968919.1.27445 WP_000968919.1.2745 WP_000968919.1.27451 WP_000968919.1.27472 WP_000968919.1.27504 WP_000968919.1.27518 WP_000968919.1.27520 WP_000968919.1.27524 WP_000968919.1.2755 WP_000968919.1.27560 WP_000968919.1.27585 WP_000968919.1.27611 WP_000968919.1.27618 WP_000968919.1.27683 WP_000968919.1.27691 WP_000968919.1.27693 WP_000968919.1.27698 WP_000968919.1.27723 WP_000968919.1.27734 WP_000968919.1.27741 WP_000968919.1.27742 WP_000968919.1.27749 WP_000968919.1.27758 WP_000968919.1.27786 WP_000968919.1.2779 WP_000968919.1.27797 WP_000968919.1.27861 WP_000968919.1.27871 WP_000968919.1.27876 WP_000968919.1.27879 WP_000968919.1.27913 WP_000968919.1.27923 WP_000968919.1.27957 WP_000968919.1.27971 WP_000968919.1.27998 WP_000968919.1.28008 WP_000968919.1.28026 WP_000968919.1.28109 WP_000968919.1.28110 WP_000968919.1.28128 WP_000968919.1.28143 WP_000968919.1.28145 WP_000968919.1.28156 WP_000968919.1.28167 WP_000968919.1.28168 WP_000968919.1.28184 WP_000968919.1.28199 WP_000968919.1.2823 WP_000968919.1.28250 WP_000968919.1.2826 WP_000968919.1.28268 WP_000968919.1.28271 WP_000968919.1.28305 WP_000968919.1.28314 WP_000968919.1.28318 WP_000968919.1.28322 WP_000968919.1.28345 WP_000968919.1.28349 WP_000968919.1.28371 WP_000968919.1.2838 WP_000968919.1.28401 WP_000968919.1.28414 WP_000968919.1.28433 WP_000968919.1.28440 WP_000968919.1.28461 WP_000968919.1.28476 WP_000968919.1.28491 WP_000968919.1.28496 WP_000968919.1.28500 WP_000968919.1.28509 WP_000968919.1.28523 WP_000968919.1.28540 WP_000968919.1.28551 WP_000968919.1.28554 WP_000968919.1.28568 WP_000968919.1.2866 WP_000968919.1.28662 WP_000968919.1.28697 WP_000968919.1.28711 WP_000968919.1.28723 WP_000968919.1.28732 WP_000968919.1.28734 WP_000968919.1.28736 WP_000968919.1.28742 WP_000968919.1.28760 WP_000968919.1.28762 WP_000968919.1.28769 WP_000968919.1.28791 WP_000968919.1.28809 WP_000968919.1.2881 WP_000968919.1.28829 WP_000968919.1.28835 WP_000968919.1.28863 WP_000968919.1.28879 WP_000968919.1.28919 WP_000968919.1.28924 WP_000968919.1.28950 WP_000968919.1.28953 WP_000968919.1.28982 WP_000968919.1.28994 WP_000968919.1.29001 WP_000968919.1.29013 WP_000968919.1.29049 WP_000968919.1.29055 WP_000968919.1.29061 WP_000968919.1.29079 WP_000968919.1.29082 WP_000968919.1.291 WP_000968919.1.29125 WP_000968919.1.29126 WP_000968919.1.29128 WP_000968919.1.29146 WP_000968919.1.29150 WP_000968919.1.29164 WP_000968919.1.29176 WP_000968919.1.29194 WP_000968919.1.29197 WP_000968919.1.29202 WP_000968919.1.29206 WP_000968919.1.29221 WP_000968919.1.29239 WP_000968919.1.29252 WP_000968919.1.29258 WP_000968919.1.2926 WP_000968919.1.2931 WP_000968919.1.29341 WP_000968919.1.29377 WP_000968919.1.29394 WP_000968919.1.29404 WP_000968919.1.2942 WP_000968919.1.29429 WP_000968919.1.29443 WP_000968919.1.2945 WP_000968919.1.29486 WP_000968919.1.29495 WP_000968919.1.29497 WP_000968919.1.29503 WP_000968919.1.29523 WP_000968919.1.2954 WP_000968919.1.29556 WP_000968919.1.29564 WP_000968919.1.29590 WP_000968919.1.29597 WP_000968919.1.29603 WP_000968919.1.29618 WP_000968919.1.2963 WP_000968919.1.29643 WP_000968919.1.29647 WP_000968919.1.29662 WP_000968919.1.29669 WP_000968919.1.29683 WP_000968919.1.29699 WP_000968919.1.29724 WP_000968919.1.29740 WP_000968919.1.29746 WP_000968919.1.29752 WP_000968919.1.2978 WP_000968919.1.29812 WP_000968919.1.29818 WP_000968919.1.29819 WP_000968919.1.29840 WP_000968919.1.29855 WP_000968919.1.2986 WP_000968919.1.29874 WP_000968919.1.29933 WP_000968919.1.2995 WP_000968919.1.29967 WP_000968919.1.29976 WP_000968919.1.29979 WP_000968919.1.30 WP_000968919.1.30004 WP_000968919.1.30016 WP_000968919.1.30019 WP_000968919.1.30052 WP_000968919.1.30063 WP_000968919.1.30064 WP_000968919.1.30098 WP_000968919.1.30105 WP_000968919.1.30123 WP_000968919.1.30141 WP_000968919.1.30164 WP_000968919.1.3018 WP_000968919.1.30221 WP_000968919.1.30231 WP_000968919.1.30232 WP_000968919.1.30239 WP_000968919.1.30247 WP_000968919.1.30253 WP_000968919.1.30298 WP_000968919.1.30347 WP_000968919.1.30391 WP_000968919.1.30397 WP_000968919.1.30399 WP_000968919.1.30400 WP_000968919.1.30401 WP_000968919.1.30428 WP_000968919.1.30447 WP_000968919.1.3045 WP_000968919.1.30452 WP_000968919.1.30472 WP_000968919.1.30476 WP_000968919.1.30479 WP_000968919.1.30497 WP_000968919.1.30524 WP_000968919.1.30536 WP_000968919.1.30546 WP_000968919.1.3055 WP_000968919.1.30550 WP_000968919.1.30554 WP_000968919.1.30580 WP_000968919.1.306 WP_000968919.1.3063 WP_000968919.1.30630 WP_000968919.1.30637 WP_000968919.1.30639 WP_000968919.1.30640 WP_000968919.1.30658 WP_000968919.1.30665 WP_000968919.1.30691 WP_000968919.1.30700 WP_000968919.1.30742 WP_000968919.1.30749 WP_000968919.1.30783 WP_000968919.1.30808 WP_000968919.1.3083 WP_000968919.1.30853 WP_000968919.1.30866 WP_000968919.1.30867 WP_000968919.1.30879 WP_000968919.1.30887 WP_000968919.1.309 WP_000968919.1.30906 WP_000968919.1.30918 WP_000968919.1.30960 WP_000968919.1.30993 WP_000968919.1.30999 WP_000968919.1.31000 WP_000968919.1.31009 WP_000968919.1.31017 WP_000968919.1.31026 WP_000968919.1.31029 WP_000968919.1.31055 WP_000968919.1.31119 WP_000968919.1.31129 WP_000968919.1.31142 WP_000968919.1.31154 WP_000968919.1.31188 WP_000968919.1.312 WP_000968919.1.31211 WP_000968919.1.31252 WP_000968919.1.31295 WP_000968919.1.31319 WP_000968919.1.31340 WP_000968919.1.31347 WP_000968919.1.31353 WP_000968919.1.31379 WP_000968919.1.3140 WP_000968919.1.31401 WP_000968919.1.31407 WP_000968919.1.31419 WP_000968919.1.31421 WP_000968919.1.31422 WP_000968919.1.31433 WP_000968919.1.31434 WP_000968919.1.3147 WP_000968919.1.31482 WP_000968919.1.31506 WP_000968919.1.31511 WP_000968919.1.31521 WP_000968919.1.31527 WP_000968919.1.31557 WP_000968919.1.31575 WP_000968919.1.31596 WP_000968919.1.31614 WP_000968919.1.31625 WP_000968919.1.31639 WP_000968919.1.31657 WP_000968919.1.31675 WP_000968919.1.31679 WP_000968919.1.31681 WP_000968919.1.3169 WP_000968919.1.31696 WP_000968919.1.31709 WP_000968919.1.31715 WP_000968919.1.31736 WP_000968919.1.31740 WP_000968919.1.3176 WP_000968919.1.31801 WP_000968919.1.31803 WP_000968919.1.3181 WP_000968919.1.31825 WP_000968919.1.31833 WP_000968919.1.31835 WP_000968919.1.31839 WP_000968919.1.31860 WP_000968919.1.31866 WP_000968919.1.31898 WP_000968919.1.31899 WP_000968919.1.31903 WP_000968919.1.31924 WP_000968919.1.31928 WP_000968919.1.31937 WP_000968919.1.31956 WP_000968919.1.31978 WP_000968919.1.3201 WP_000968919.1.32020 WP_000968919.1.32021 WP_000968919.1.32024 WP_000968919.1.3203 WP_000968919.1.32030 WP_000968919.1.32037 WP_000968919.1.32049 WP_000968919.1.32063 WP_000968919.1.32078 WP_000968919.1.32089 WP_000968919.1.32091 WP_000968919.1.32093 WP_000968919.1.32121 WP_000968919.1.32127 WP_000968919.1.32143 WP_000968919.1.3215 WP_000968919.1.32173 WP_000968919.1.32184 WP_000968919.1.322 WP_000968919.1.32222 WP_000968919.1.32225 WP_000968919.1.32232 WP_000968919.1.32234 WP_000968919.1.32236 WP_000968919.1.32242 WP_000968919.1.32243 WP_000968919.1.32279 WP_000968919.1.32287 WP_000968919.1.3233 WP_000968919.1.32333 WP_000968919.1.32394 WP_000968919.1.32406 WP_000968919.1.32432 WP_000968919.1.32435 WP_000968919.1.32443 WP_000968919.1.32448 WP_000968919.1.32478 WP_000968919.1.32479 WP_000968919.1.32480 WP_000968919.1.32494 WP_000968919.1.32509 WP_000968919.1.32518 WP_000968919.1.32536 WP_000968919.1.32558 WP_000968919.1.32561 WP_000968919.1.32574 WP_000968919.1.32580 WP_000968919.1.32587 WP_000968919.1.3259 WP_000968919.1.32590 WP_000968919.1.32601 WP_000968919.1.32635 WP_000968919.1.32650 WP_000968919.1.32655 WP_000968919.1.32661 WP_000968919.1.32680 WP_000968919.1.3269 WP_000968919.1.327 WP_000968919.1.32709 WP_000968919.1.32715 WP_000968919.1.32720 WP_000968919.1.32722 WP_000968919.1.32724 WP_000968919.1.32741 WP_000968919.1.32748 WP_000968919.1.32811 WP_000968919.1.32815 WP_000968919.1.32835 WP_000968919.1.32888 WP_000968919.1.32903 WP_000968919.1.32931 WP_000968919.1.32938 WP_000968919.1.32946 WP_000968919.1.3295 WP_000968919.1.32959 WP_000968919.1.32972 WP_000968919.1.32984 WP_000968919.1.32992 WP_000968919.1.33004 WP_000968919.1.33014 WP_000968919.1.33018 WP_000968919.1.33022 WP_000968919.1.33026 WP_000968919.1.33046 WP_000968919.1.33049 WP_000968919.1.33053 WP_000968919.1.33055 WP_000968919.1.33094 WP_000968919.1.33119 WP_000968919.1.33125 WP_000968919.1.33146 WP_000968919.1.33167 WP_000968919.1.33171 WP_000968919.1.33178 WP_000968919.1.33179 WP_000968919.1.33222 WP_000968919.1.3323 WP_000968919.1.33237 WP_000968919.1.33238 WP_000968919.1.33244 WP_000968919.1.33268 WP_000968919.1.33303 WP_000968919.1.33325 WP_000968919.1.33352 WP_000968919.1.33362 WP_000968919.1.33385 WP_000968919.1.334 WP_000968919.1.33408 WP_000968919.1.33410 WP_000968919.1.33413 WP_000968919.1.33422 WP_000968919.1.33424 WP_000968919.1.3344 WP_000968919.1.33475 WP_000968919.1.33476 WP_000968919.1.33502 WP_000968919.1.33512 WP_000968919.1.33526 WP_000968919.1.33545 WP_000968919.1.33561 WP_000968919.1.33565 WP_000968919.1.33584 WP_000968919.1.33595 WP_000968919.1.33631 WP_000968919.1.33638 WP_000968919.1.33648 WP_000968919.1.33667 WP_000968919.1.33680 WP_000968919.1.33729 WP_000968919.1.33736 WP_000968919.1.33745 WP_000968919.1.33746 WP_000968919.1.33780 WP_000968919.1.33799 WP_000968919.1.33823 WP_000968919.1.33853 WP_000968919.1.33879 WP_000968919.1.33888 WP_000968919.1.33896 WP_000968919.1.33905 WP_000968919.1.33914 WP_000968919.1.33948 WP_000968919.1.33952 WP_000968919.1.33973 WP_000968919.1.33974 WP_000968919.1.33979 WP_000968919.1.33981 WP_000968919.1.34003 WP_000968919.1.3401 WP_000968919.1.34032 WP_000968919.1.34094 WP_000968919.1.3411 WP_000968919.1.34117 WP_000968919.1.34121 WP_000968919.1.34122 WP_000968919.1.34124 WP_000968919.1.34130 WP_000968919.1.3415 WP_000968919.1.342 WP_000968919.1.34204 WP_000968919.1.34206 WP_000968919.1.34208 WP_000968919.1.34224 WP_000968919.1.34269 WP_000968919.1.34273 WP_000968919.1.34277 WP_000968919.1.34294 WP_000968919.1.34332 WP_000968919.1.34341 WP_000968919.1.34362 WP_000968919.1.34363 WP_000968919.1.34380 WP_000968919.1.34383 WP_000968919.1.3439 WP_000968919.1.34397 WP_000968919.1.34400 WP_000968919.1.34422 WP_000968919.1.3444 WP_000968919.1.34440 WP_000968919.1.34444 WP_000968919.1.34456 WP_000968919.1.34464 WP_000968919.1.34500 WP_000968919.1.34525 WP_000968919.1.34528 WP_000968919.1.34532 WP_000968919.1.34538 WP_000968919.1.34541 WP_000968919.1.34557 WP_000968919.1.3460 WP_000968919.1.34655 WP_000968919.1.34668 WP_000968919.1.34680 WP_000968919.1.34682 WP_000968919.1.34683 WP_000968919.1.34686 WP_000968919.1.3469 WP_000968919.1.347 WP_000968919.1.34763 WP_000968919.1.34781 WP_000968919.1.34782 WP_000968919.1.34794 WP_000968919.1.34827 WP_000968919.1.34855 WP_000968919.1.34875 WP_000968919.1.34887 WP_000968919.1.34948 WP_000968919.1.34966 WP_000968919.1.34982 WP_000968919.1.34983 WP_000968919.1.34990 WP_000968919.1.34993 WP_000968919.1.35003 WP_000968919.1.35006 WP_000968919.1.35007 WP_000968919.1.35107 WP_000968919.1.35127 WP_000968919.1.3515 WP_000968919.1.35186 WP_000968919.1.35198 WP_000968919.1.35202 WP_000968919.1.35204 WP_000968919.1.35208 WP_000968919.1.3521 WP_000968919.1.35211 WP_000968919.1.35258 WP_000968919.1.35316 WP_000968919.1.35328 WP_000968919.1.35360 WP_000968919.1.35365 WP_000968919.1.35368 WP_000968919.1.35376 WP_000968919.1.3539 WP_000968919.1.35393 WP_000968919.1.35394 WP_000968919.1.35398 WP_000968919.1.35448 WP_000968919.1.35464 WP_000968919.1.35466 WP_000968919.1.35468 WP_000968919.1.35483 WP_000968919.1.3550 WP_000968919.1.35552 WP_000968919.1.35578 WP_000968919.1.35581 WP_000968919.1.3560 WP_000968919.1.35627 WP_000968919.1.35632 WP_000968919.1.35649 WP_000968919.1.35651 WP_000968919.1.35653 WP_000968919.1.35654 WP_000968919.1.35698 WP_000968919.1.35704 WP_000968919.1.35724 WP_000968919.1.35741 WP_000968919.1.35789 WP_000968919.1.35889 WP_000968919.1.35904 WP_000968919.1.35922 WP_000968919.1.35927 WP_000968919.1.35934 WP_000968919.1.35942 WP_000968919.1.35959 WP_000968919.1.35963 WP_000968919.1.35983 WP_000968919.1.35987 WP_000968919.1.35990 WP_000968919.1.3600 WP_000968919.1.36010 WP_000968919.1.36040 WP_000968919.1.36070 WP_000968919.1.36071 WP_000968919.1.36085 WP_000968919.1.36094 WP_000968919.1.36129 WP_000968919.1.36159 WP_000968919.1.36164 WP_000968919.1.36166 WP_000968919.1.36182 WP_000968919.1.3620 WP_000968919.1.36207 WP_000968919.1.36212 WP_000968919.1.36281 WP_000968919.1.36299 WP_000968919.1.36332 WP_000968919.1.36334 WP_000968919.1.36352 WP_000968919.1.36386 WP_000968919.1.36393 WP_000968919.1.36405 WP_000968919.1.36412 WP_000968919.1.36426 WP_000968919.1.3643 WP_000968919.1.36453 WP_000968919.1.36459 WP_000968919.1.36496 WP_000968919.1.36500 WP_000968919.1.36537 WP_000968919.1.36610 WP_000968919.1.36626 WP_000968919.1.36627 WP_000968919.1.36699 WP_000968919.1.36707 WP_000968919.1.3671 WP_000968919.1.36724 WP_000968919.1.36739 WP_000968919.1.36746 WP_000968919.1.36747 WP_000968919.1.36761 WP_000968919.1.36767 WP_000968919.1.36806 WP_000968919.1.36826 WP_000968919.1.36833 WP_000968919.1.36856 WP_000968919.1.36904 WP_000968919.1.3697 WP_000968919.1.36971 WP_000968919.1.37006 WP_000968919.1.37032 WP_000968919.1.37049 WP_000968919.1.37057 WP_000968919.1.37076 WP_000968919.1.37099 WP_000968919.1.37101 WP_000968919.1.37102 WP_000968919.1.37103 WP_000968919.1.37122 WP_000968919.1.37146 WP_000968919.1.37153 WP_000968919.1.37155 WP_000968919.1.37206 WP_000968919.1.37226 WP_000968919.1.3723 WP_000968919.1.37233 WP_000968919.1.37252 WP_000968919.1.37261 WP_000968919.1.37266 WP_000968919.1.3730 WP_000968919.1.37306 WP_000968919.1.37312 WP_000968919.1.37329 WP_000968919.1.37334 WP_000968919.1.37337 WP_000968919.1.37342 WP_000968919.1.37372 WP_000968919.1.37388 WP_000968919.1.37419 WP_000968919.1.37433 WP_000968919.1.37445 WP_000968919.1.37472 WP_000968919.1.37476 WP_000968919.1.37477 WP_000968919.1.37485 WP_000968919.1.3749 WP_000968919.1.37510 WP_000968919.1.37516 WP_000968919.1.37543 WP_000968919.1.37544 WP_000968919.1.37548 WP_000968919.1.37549 WP_000968919.1.37550 WP_000968919.1.37554 WP_000968919.1.37576 WP_000968919.1.37588 WP_000968919.1.37592 WP_000968919.1.37608 WP_000968919.1.3762 WP_000968919.1.37634 WP_000968919.1.37637 WP_000968919.1.37664 WP_000968919.1.377 WP_000968919.1.37730 WP_000968919.1.37731 WP_000968919.1.37750 WP_000968919.1.37762 WP_000968919.1.37766 WP_000968919.1.37769 WP_000968919.1.37773 WP_000968919.1.37817 WP_000968919.1.37847 WP_000968919.1.37853 WP_000968919.1.3788 WP_000968919.1.37887 WP_000968919.1.37897 WP_000968919.1.37923 WP_000968919.1.37926 WP_000968919.1.37940 WP_000968919.1.3795 WP_000968919.1.3796 WP_000968919.1.37962 WP_000968919.1.37964 WP_000968919.1.37984 WP_000968919.1.37995 WP_000968919.1.37998 WP_000968919.1.38000 WP_000968919.1.38043 WP_000968919.1.38050 WP_000968919.1.38063 WP_000968919.1.38080 WP_000968919.1.38081 WP_000968919.1.38085 WP_000968919.1.38103 WP_000968919.1.38105 WP_000968919.1.38107 WP_000968919.1.3811 WP_000968919.1.38119 WP_000968919.1.38120 WP_000968919.1.3815 WP_000968919.1.38155 WP_000968919.1.38162 WP_000968919.1.38182 WP_000968919.1.38185 WP_000968919.1.38202 WP_000968919.1.38211 WP_000968919.1.3822 WP_000968919.1.38257 WP_000968919.1.38264 WP_000968919.1.38300 WP_000968919.1.38306 WP_000968919.1.38314 WP_000968919.1.38323 WP_000968919.1.38357 WP_000968919.1.38369 WP_000968919.1.38392 WP_000968919.1.38412 WP_000968919.1.38419 WP_000968919.1.38485 WP_000968919.1.38533 WP_000968919.1.38544 WP_000968919.1.38561 WP_000968919.1.38610 WP_000968919.1.38626 WP_000968919.1.38629 WP_000968919.1.38636 WP_000968919.1.38694 WP_000968919.1.38722 WP_000968919.1.3873 WP_000968919.1.38751 WP_000968919.1.38782 WP_000968919.1.38811 WP_000968919.1.38827 WP_000968919.1.38835 WP_000968919.1.38843 WP_000968919.1.38896 WP_000968919.1.389 WP_000968919.1.38911 WP_000968919.1.38950 WP_000968919.1.38956 WP_000968919.1.38958 WP_000968919.1.39015 WP_000968919.1.3903 WP_000968919.1.39037 WP_000968919.1.3904 WP_000968919.1.39042 WP_000968919.1.39063 WP_000968919.1.39111 WP_000968919.1.3912 WP_000968919.1.39123 WP_000968919.1.39150 WP_000968919.1.39155 WP_000968919.1.39157 WP_000968919.1.39164 WP_000968919.1.39167 WP_000968919.1.39171 WP_000968919.1.39180 WP_000968919.1.39184 WP_000968919.1.39209 WP_000968919.1.3921 WP_000968919.1.39232 WP_000968919.1.39249 WP_000968919.1.39268 WP_000968919.1.39286 WP_000968919.1.39289 WP_000968919.1.39305 WP_000968919.1.39310 WP_000968919.1.39313 WP_000968919.1.39325 WP_000968919.1.39335 WP_000968919.1.39342 WP_000968919.1.39356 WP_000968919.1.39358 WP_000968919.1.39365 WP_000968919.1.39367 WP_000968919.1.39373 WP_000968919.1.39377 WP_000968919.1.39401 WP_000968919.1.39402 WP_000968919.1.39415 WP_000968919.1.39423 WP_000968919.1.39430 WP_000968919.1.39468 WP_000968919.1.39481 WP_000968919.1.39492 WP_000968919.1.39531 WP_000968919.1.3954 WP_000968919.1.39541 WP_000968919.1.39564 WP_000968919.1.39575 WP_000968919.1.39580 WP_000968919.1.39601 WP_000968919.1.39607 WP_000968919.1.39610 WP_000968919.1.39626 WP_000968919.1.39646 WP_000968919.1.39651 WP_000968919.1.39708 WP_000968919.1.39709 WP_000968919.1.39713 WP_000968919.1.39715 WP_000968919.1.39717 WP_000968919.1.39726 WP_000968919.1.39730 WP_000968919.1.39734 WP_000968919.1.39758 WP_000968919.1.39780 WP_000968919.1.39796 WP_000968919.1.3980 WP_000968919.1.39809 WP_000968919.1.39818 WP_000968919.1.39820 WP_000968919.1.39822 WP_000968919.1.39829 WP_000968919.1.39867 WP_000968919.1.39870 WP_000968919.1.39938 WP_000968919.1.39961 WP_000968919.1.39966 WP_000968919.1.39973 WP_000968919.1.39992 WP_000968919.1.39998 WP_000968919.1.40 WP_000968919.1.40013 WP_000968919.1.40016 WP_000968919.1.40019 WP_000968919.1.40083 WP_000968919.1.40088 WP_000968919.1.40107 WP_000968919.1.40113 WP_000968919.1.40121 WP_000968919.1.40140 WP_000968919.1.40147 WP_000968919.1.40153 WP_000968919.1.40159 WP_000968919.1.40183 WP_000968919.1.40190 WP_000968919.1.40192 WP_000968919.1.40212 WP_000968919.1.40218 WP_000968919.1.40234 WP_000968919.1.40298 WP_000968919.1.4030 WP_000968919.1.40300 WP_000968919.1.40315 WP_000968919.1.40317 WP_000968919.1.40319 WP_000968919.1.40335 WP_000968919.1.40345 WP_000968919.1.40349 WP_000968919.1.40360 WP_000968919.1.40382 WP_000968919.1.40389 WP_000968919.1.40391 WP_000968919.1.40403 WP_000968919.1.40445 WP_000968919.1.40486 WP_000968919.1.4049 WP_000968919.1.40499 WP_000968919.1.40502 WP_000968919.1.40509 WP_000968919.1.40524 WP_000968919.1.40539 WP_000968919.1.40548 WP_000968919.1.40549 WP_000968919.1.40560 WP_000968919.1.40563 WP_000968919.1.40596 WP_000968919.1.40599 WP_000968919.1.40607 WP_000968919.1.40617 WP_000968919.1.40623 WP_000968919.1.40629 WP_000968919.1.40636 WP_000968919.1.40657 WP_000968919.1.40660 WP_000968919.1.40666 WP_000968919.1.40668 WP_000968919.1.40712 WP_000968919.1.40715 WP_000968919.1.40742 WP_000968919.1.40758 WP_000968919.1.40781 WP_000968919.1.40793 WP_000968919.1.4081 WP_000968919.1.40813 WP_000968919.1.40815 WP_000968919.1.4082 WP_000968919.1.40833 WP_000968919.1.40842 WP_000968919.1.40843 WP_000968919.1.40865 WP_000968919.1.40882 WP_000968919.1.40898 WP_000968919.1.40900 WP_000968919.1.40912 WP_000968919.1.40937 WP_000968919.1.40952 WP_000968919.1.4103 WP_000968919.1.41037 WP_000968919.1.41041 WP_000968919.1.41045 WP_000968919.1.41060 WP_000968919.1.41063 WP_000968919.1.41078 WP_000968919.1.41113 WP_000968919.1.41147 WP_000968919.1.41206 WP_000968919.1.4122 WP_000968919.1.41230 WP_000968919.1.41244 WP_000968919.1.41259 WP_000968919.1.4126 WP_000968919.1.41287 WP_000968919.1.41294 WP_000968919.1.41315 WP_000968919.1.41330 WP_000968919.1.41332 WP_000968919.1.41339 WP_000968919.1.41363 WP_000968919.1.41368 WP_000968919.1.41372 WP_000968919.1.41391 WP_000968919.1.41394 WP_000968919.1.41401 WP_000968919.1.41407 WP_000968919.1.4142 WP_000968919.1.41436 WP_000968919.1.41449 WP_000968919.1.41453 WP_000968919.1.41457 WP_000968919.1.41466 WP_000968919.1.41478 WP_000968919.1.41479 WP_000968919.1.41481 WP_000968919.1.41482 WP_000968919.1.41483 WP_000968919.1.41488 WP_000968919.1.41513 WP_000968919.1.41530 WP_000968919.1.41536 WP_000968919.1.41539 WP_000968919.1.41545 WP_000968919.1.41556 WP_000968919.1.41566 WP_000968919.1.4158 WP_000968919.1.41606 WP_000968919.1.41613 WP_000968919.1.41621 WP_000968919.1.41651 WP_000968919.1.41712 WP_000968919.1.41718 WP_000968919.1.4172 WP_000968919.1.41734 WP_000968919.1.41740 WP_000968919.1.41741 WP_000968919.1.41778 WP_000968919.1.41782 WP_000968919.1.41783 WP_000968919.1.41813 WP_000968919.1.41822 WP_000968919.1.41837 WP_000968919.1.41849 WP_000968919.1.41884 WP_000968919.1.41885 WP_000968919.1.41900 WP_000968919.1.4193 WP_000968919.1.41956 WP_000968919.1.41960 WP_000968919.1.41964 WP_000968919.1.41988 WP_000968919.1.41990 WP_000968919.1.41991 WP_000968919.1.42022 WP_000968919.1.42027 WP_000968919.1.42033 WP_000968919.1.42036 WP_000968919.1.42060 WP_000968919.1.42073 WP_000968919.1.42095 WP_000968919.1.42096 WP_000968919.1.42113 WP_000968919.1.4213 WP_000968919.1.4214 WP_000968919.1.42191 WP_000968919.1.42209 WP_000968919.1.42214 WP_000968919.1.42221 WP_000968919.1.42226 WP_000968919.1.42228 WP_000968919.1.42233 WP_000968919.1.4224 WP_000968919.1.42252 WP_000968919.1.42258 WP_000968919.1.42277 WP_000968919.1.42284 WP_000968919.1.42300 WP_000968919.1.42318 WP_000968919.1.42359 WP_000968919.1.42367 WP_000968919.1.42369 WP_000968919.1.42376 WP_000968919.1.4242 WP_000968919.1.42432 WP_000968919.1.42447 WP_000968919.1.42448 WP_000968919.1.42456 WP_000968919.1.42480 WP_000968919.1.4250 WP_000968919.1.42513 WP_000968919.1.42516 WP_000968919.1.42522 WP_000968919.1.42547 WP_000968919.1.42586 WP_000968919.1.42594 WP_000968919.1.42597 WP_000968919.1.42600 WP_000968919.1.42601 WP_000968919.1.4261 WP_000968919.1.42632 WP_000968919.1.42661 WP_000968919.1.42669 WP_000968919.1.42677 WP_000968919.1.42728 WP_000968919.1.42748 WP_000968919.1.42749 WP_000968919.1.42750 WP_000968919.1.42756 WP_000968919.1.42761 WP_000968919.1.42770 WP_000968919.1.42771 WP_000968919.1.42791 WP_000968919.1.42813 WP_000968919.1.4282 WP_000968919.1.42828 WP_000968919.1.42830 WP_000968919.1.42832 WP_000968919.1.42863 WP_000968919.1.42879 WP_000968919.1.42891 WP_000968919.1.4290 WP_000968919.1.42903 WP_000968919.1.42918 WP_000968919.1.42936 WP_000968919.1.42937 WP_000968919.1.42950 WP_000968919.1.42962 WP_000968919.1.42966 WP_000968919.1.42970 WP_000968919.1.42975 WP_000968919.1.42989 WP_000968919.1.42991 WP_000968919.1.43013 WP_000968919.1.43027 WP_000968919.1.43035 WP_000968919.1.4306 WP_000968919.1.43079 WP_000968919.1.43121 WP_000968919.1.4313 WP_000968919.1.43132 WP_000968919.1.43133 WP_000968919.1.43140 WP_000968919.1.43166 WP_000968919.1.43170 WP_000968919.1.43174 WP_000968919.1.43196 WP_000968919.1.43213 WP_000968919.1.43216 WP_000968919.1.43239 WP_000968919.1.43270 WP_000968919.1.43278 WP_000968919.1.43324 WP_000968919.1.4334 WP_000968919.1.43363 WP_000968919.1.43374 WP_000968919.1.43384 WP_000968919.1.43427 WP_000968919.1.4343 WP_000968919.1.43448 WP_000968919.1.43469 WP_000968919.1.43473 WP_000968919.1.43474 WP_000968919.1.43489 WP_000968919.1.43501 WP_000968919.1.43536 WP_000968919.1.4356 WP_000968919.1.43561 WP_000968919.1.43566 WP_000968919.1.43598 WP_000968919.1.43604 WP_000968919.1.43622 WP_000968919.1.43642 WP_000968919.1.43720 WP_000968919.1.43738 WP_000968919.1.43750 WP_000968919.1.43754 WP_000968919.1.43769 WP_000968919.1.43798 WP_000968919.1.43804 WP_000968919.1.43816 WP_000968919.1.43837 WP_000968919.1.43858 WP_000968919.1.43868 WP_000968919.1.43898 WP_000968919.1.43911 WP_000968919.1.43918 WP_000968919.1.43939 WP_000968919.1.43942 WP_000968919.1.43953 WP_000968919.1.43966 WP_000968919.1.4400 WP_000968919.1.44020 WP_000968919.1.44040 WP_000968919.1.44051 WP_000968919.1.44075 WP_000968919.1.44088 WP_000968919.1.44096 WP_000968919.1.44100 WP_000968919.1.4411 WP_000968919.1.44115 WP_000968919.1.44125 WP_000968919.1.44130 WP_000968919.1.4415 WP_000968919.1.44162 WP_000968919.1.44165 WP_000968919.1.44166 WP_000968919.1.44201 WP_000968919.1.44203 WP_000968919.1.44211 WP_000968919.1.44222 WP_000968919.1.44238 WP_000968919.1.44263 WP_000968919.1.44264 WP_000968919.1.44273 WP_000968919.1.44285 WP_000968919.1.44287 WP_000968919.1.44292 WP_000968919.1.44314 WP_000968919.1.44324 WP_000968919.1.44327 WP_000968919.1.44354 WP_000968919.1.44365 WP_000968919.1.44389 WP_000968919.1.44422 WP_000968919.1.44424 WP_000968919.1.44426 WP_000968919.1.44445 WP_000968919.1.44447 WP_000968919.1.4445 WP_000968919.1.44458 WP_000968919.1.44461 WP_000968919.1.44488 WP_000968919.1.44524 WP_000968919.1.44539 WP_000968919.1.44558 WP_000968919.1.44561 WP_000968919.1.44587 WP_000968919.1.4459 WP_000968919.1.44608 WP_000968919.1.44610 WP_000968919.1.44622 WP_000968919.1.44627 WP_000968919.1.44649 WP_000968919.1.44661 WP_000968919.1.44668 WP_000968919.1.44671 WP_000968919.1.44686 WP_000968919.1.44717 WP_000968919.1.44733 WP_000968919.1.44756 WP_000968919.1.44784 WP_000968919.1.448 WP_000968919.1.44800 WP_000968919.1.44814 WP_000968919.1.44818 WP_000968919.1.44821 WP_000968919.1.44836 WP_000968919.1.44841 WP_000968919.1.44848 WP_000968919.1.44849 WP_000968919.1.44854 WP_000968919.1.44855 WP_000968919.1.44906 WP_000968919.1.44923 WP_000968919.1.44954 WP_000968919.1.44960 WP_000968919.1.44961 WP_000968919.1.44970 WP_000968919.1.44975 WP_000968919.1.44977 WP_000968919.1.44980 WP_000968919.1.45000 WP_000968919.1.45020 WP_000968919.1.45025 WP_000968919.1.45028 WP_000968919.1.45043 WP_000968919.1.45053 WP_000968919.1.45068 WP_000968919.1.45076 WP_000968919.1.45104 WP_000968919.1.45153 WP_000968919.1.45156 WP_000968919.1.4516 WP_000968919.1.45190 WP_000968919.1.45195 WP_000968919.1.45208 WP_000968919.1.4524 WP_000968919.1.45246 WP_000968919.1.45293 WP_000968919.1.4530 WP_000968919.1.45301 WP_000968919.1.45313 WP_000968919.1.45329 WP_000968919.1.4535 WP_000968919.1.45359 WP_000968919.1.45392 WP_000968919.1.45404 WP_000968919.1.45405 WP_000968919.1.45440 WP_000968919.1.45444 WP_000968919.1.4549 WP_000968919.1.45494 WP_000968919.1.45500 WP_000968919.1.45525 WP_000968919.1.45536 WP_000968919.1.45565 WP_000968919.1.45575 WP_000968919.1.45581 WP_000968919.1.45595 WP_000968919.1.45600 WP_000968919.1.45627 WP_000968919.1.4563 WP_000968919.1.45664 WP_000968919.1.45674 WP_000968919.1.45676 WP_000968919.1.45707 WP_000968919.1.45718 WP_000968919.1.4574 WP_000968919.1.45741 WP_000968919.1.45752 WP_000968919.1.4576 WP_000968919.1.45789 WP_000968919.1.45793 WP_000968919.1.45799 WP_000968919.1.45801 WP_000968919.1.45806 WP_000968919.1.4583 WP_000968919.1.45840 WP_000968919.1.45841 WP_000968919.1.45846 WP_000968919.1.45865 WP_000968919.1.45891 WP_000968919.1.45901 WP_000968919.1.45921 WP_000968919.1.4593 WP_000968919.1.45930 WP_000968919.1.45931 WP_000968919.1.45933 WP_000968919.1.45941 WP_000968919.1.45945 WP_000968919.1.45949 WP_000968919.1.45962 WP_000968919.1.45968 WP_000968919.1.45991 WP_000968919.1.4600 WP_000968919.1.46016 WP_000968919.1.46026 WP_000968919.1.46027 WP_000968919.1.46039 WP_000968919.1.46048 WP_000968919.1.46049 WP_000968919.1.46070 WP_000968919.1.46081 WP_000968919.1.46097 WP_000968919.1.4610 WP_000968919.1.46115 WP_000968919.1.4613 WP_000968919.1.46164 WP_000968919.1.4617 WP_000968919.1.46186 WP_000968919.1.4619 WP_000968919.1.46197 WP_000968919.1.46213 WP_000968919.1.46217 WP_000968919.1.46245 WP_000968919.1.46257 WP_000968919.1.46282 WP_000968919.1.46291 WP_000968919.1.46301 WP_000968919.1.46325 WP_000968919.1.46329 WP_000968919.1.46369 WP_000968919.1.46378 WP_000968919.1.46379 WP_000968919.1.46414 WP_000968919.1.46429 WP_000968919.1.4643 WP_000968919.1.46438 WP_000968919.1.46441 WP_000968919.1.46451 WP_000968919.1.4646 WP_000968919.1.46468 WP_000968919.1.4647 WP_000968919.1.46477 WP_000968919.1.46487 WP_000968919.1.46503 WP_000968919.1.46541 WP_000968919.1.46552 WP_000968919.1.46555 WP_000968919.1.46573 WP_000968919.1.46582 WP_000968919.1.46589 WP_000968919.1.46594 WP_000968919.1.46597 WP_000968919.1.46602 WP_000968919.1.46611 WP_000968919.1.46614 WP_000968919.1.46626 WP_000968919.1.46643 WP_000968919.1.46655 WP_000968919.1.4670 WP_000968919.1.46734 WP_000968919.1.46743 WP_000968919.1.46795 WP_000968919.1.46802 WP_000968919.1.46806 WP_000968919.1.46810 WP_000968919.1.46821 WP_000968919.1.46832 WP_000968919.1.46841 WP_000968919.1.46857 WP_000968919.1.46876 WP_000968919.1.46882 WP_000968919.1.46898 WP_000968919.1.46909 WP_000968919.1.4691 WP_000968919.1.46912 WP_000968919.1.46913 WP_000968919.1.46932 WP_000968919.1.4695 WP_000968919.1.46990 WP_000968919.1.46991 WP_000968919.1.46994 WP_000968919.1.47028 WP_000968919.1.47029 WP_000968919.1.47030 WP_000968919.1.47034 WP_000968919.1.47038 WP_000968919.1.47047 WP_000968919.1.47048 WP_000968919.1.47054 WP_000968919.1.47063 WP_000968919.1.47069 WP_000968919.1.4708 WP_000968919.1.47124 WP_000968919.1.47135 WP_000968919.1.47140 WP_000968919.1.47167 WP_000968919.1.47186 WP_000968919.1.47189 WP_000968919.1.47197 WP_000968919.1.4722 WP_000968919.1.47224 WP_000968919.1.4723 WP_000968919.1.47235 WP_000968919.1.47246 WP_000968919.1.4725 WP_000968919.1.47280 WP_000968919.1.47307 WP_000968919.1.47316 WP_000968919.1.47319 WP_000968919.1.47322 WP_000968919.1.47332 WP_000968919.1.47344 WP_000968919.1.47349 WP_000968919.1.47350 WP_000968919.1.47366 WP_000968919.1.47370 WP_000968919.1.47386 WP_000968919.1.47398 WP_000968919.1.4740 WP_000968919.1.47401 WP_000968919.1.47411 WP_000968919.1.47414 WP_000968919.1.47416 WP_000968919.1.4743 WP_000968919.1.47451 WP_000968919.1.47454 WP_000968919.1.47464 WP_000968919.1.47477 WP_000968919.1.47488 WP_000968919.1.47496 WP_000968919.1.47498 WP_000968919.1.47500 WP_000968919.1.47529 WP_000968919.1.47533 WP_000968919.1.47546 WP_000968919.1.47555 WP_000968919.1.47582 WP_000968919.1.47634 WP_000968919.1.47646 WP_000968919.1.47654 WP_000968919.1.47673 WP_000968919.1.47709 WP_000968919.1.4772 WP_000968919.1.47722 WP_000968919.1.4773 WP_000968919.1.47734 WP_000968919.1.47740 WP_000968919.1.47744 WP_000968919.1.47761 WP_000968919.1.47764 WP_000968919.1.47765 WP_000968919.1.47770 WP_000968919.1.47775 WP_000968919.1.47784 WP_000968919.1.47791 WP_000968919.1.47820 WP_000968919.1.47827 WP_000968919.1.4783 WP_000968919.1.47848 WP_000968919.1.4785 WP_000968919.1.47884 WP_000968919.1.47914 WP_000968919.1.47935 WP_000968919.1.47954 WP_000968919.1.47962 WP_000968919.1.47976 WP_000968919.1.47981 WP_000968919.1.47983 WP_000968919.1.47994 WP_000968919.1.48029 WP_000968919.1.48040 WP_000968919.1.48048 WP_000968919.1.48051 WP_000968919.1.48065 WP_000968919.1.48073 WP_000968919.1.48077 WP_000968919.1.48080 WP_000968919.1.48087 WP_000968919.1.48090 WP_000968919.1.48096 WP_000968919.1.48111 WP_000968919.1.4812 WP_000968919.1.48144 WP_000968919.1.48168 WP_000968919.1.48176 WP_000968919.1.48188 WP_000968919.1.48194 WP_000968919.1.48200 WP_000968919.1.48216 WP_000968919.1.48226 WP_000968919.1.48258 WP_000968919.1.48265 WP_000968919.1.48285 WP_000968919.1.48290 WP_000968919.1.48291 WP_000968919.1.48317 WP_000968919.1.48353 WP_000968919.1.48355 WP_000968919.1.48371 WP_000968919.1.48385 WP_000968919.1.48404 WP_000968919.1.48417 WP_000968919.1.48431 WP_000968919.1.48433 WP_000968919.1.48469 WP_000968919.1.48477 WP_000968919.1.48505 WP_000968919.1.48522 WP_000968919.1.48590 WP_000968919.1.486 WP_000968919.1.48602 WP_000968919.1.48615 WP_000968919.1.48678 WP_000968919.1.48697 WP_000968919.1.4871 WP_000968919.1.48712 WP_000968919.1.4876 WP_000968919.1.48771 WP_000968919.1.48792 WP_000968919.1.48801 WP_000968919.1.48806 WP_000968919.1.48825 WP_000968919.1.48827 WP_000968919.1.48847 WP_000968919.1.48860 WP_000968919.1.48901 WP_000968919.1.48902 WP_000968919.1.48907 WP_000968919.1.48910 WP_000968919.1.4892 WP_000968919.1.48921 WP_000968919.1.48926 WP_000968919.1.48928 WP_000968919.1.48953 WP_000968919.1.48954 WP_000968919.1.48974 WP_000968919.1.49001 WP_000968919.1.49009 WP_000968919.1.49076 WP_000968919.1.49107 WP_000968919.1.49136 WP_000968919.1.49147 WP_000968919.1.49170 WP_000968919.1.49179 WP_000968919.1.49190 WP_000968919.1.49229 WP_000968919.1.49243 WP_000968919.1.49258 WP_000968919.1.49259 WP_000968919.1.49275 WP_000968919.1.4931 WP_000968919.1.49312 WP_000968919.1.49321 WP_000968919.1.49332 WP_000968919.1.49336 WP_000968919.1.49338 WP_000968919.1.49342 WP_000968919.1.49347 WP_000968919.1.49363 WP_000968919.1.49401 WP_000968919.1.49431 WP_000968919.1.49446 WP_000968919.1.49459 WP_000968919.1.49464 WP_000968919.1.49481 WP_000968919.1.49482 WP_000968919.1.49483 WP_000968919.1.4949 WP_000968919.1.49496 WP_000968919.1.49521 WP_000968919.1.49528 WP_000968919.1.4953 WP_000968919.1.49531 WP_000968919.1.49537 WP_000968919.1.49546 WP_000968919.1.49567 WP_000968919.1.49594 WP_000968919.1.49599 WP_000968919.1.49615 WP_000968919.1.49621 WP_000968919.1.49625 WP_000968919.1.49645 WP_000968919.1.49655 WP_000968919.1.49661 WP_000968919.1.49684 WP_000968919.1.497 WP_000968919.1.49722 WP_000968919.1.49733 WP_000968919.1.49740 WP_000968919.1.49747 WP_000968919.1.49768 WP_000968919.1.49771 WP_000968919.1.49777 WP_000968919.1.49788 WP_000968919.1.49820 WP_000968919.1.49823 WP_000968919.1.49856 WP_000968919.1.49879 WP_000968919.1.49883 WP_000968919.1.49884 WP_000968919.1.49900 WP_000968919.1.49902 WP_000968919.1.49941 WP_000968919.1.49950 WP_000968919.1.49972 WP_000968919.1.49987 WP_000968919.1.50006 WP_000968919.1.50008 WP_000968919.1.5003 WP_000968919.1.50036 WP_000968919.1.50056 WP_000968919.1.50058 WP_000968919.1.50078 WP_000968919.1.50098 WP_000968919.1.50110 WP_000968919.1.50136 WP_000968919.1.5017 WP_000968919.1.50179 WP_000968919.1.50182 WP_000968919.1.50187 WP_000968919.1.50196 WP_000968919.1.50207 WP_000968919.1.50228 WP_000968919.1.50230 WP_000968919.1.50258 WP_000968919.1.50262 WP_000968919.1.50266 WP_000968919.1.50269 WP_000968919.1.50270 WP_000968919.1.50273 WP_000968919.1.50278 WP_000968919.1.50329 WP_000968919.1.50345 WP_000968919.1.50353 WP_000968919.1.50358 WP_000968919.1.50361 WP_000968919.1.50366 WP_000968919.1.5037 WP_000968919.1.50380 WP_000968919.1.50381 WP_000968919.1.5040 WP_000968919.1.5041 WP_000968919.1.50412 WP_000968919.1.50427 WP_000968919.1.50452 WP_000968919.1.5046 WP_000968919.1.50539 WP_000968919.1.50548 WP_000968919.1.50549 WP_000968919.1.50579 WP_000968919.1.50585 WP_000968919.1.50586 WP_000968919.1.506 WP_000968919.1.50608 WP_000968919.1.5061 WP_000968919.1.50627 WP_000968919.1.5064 WP_000968919.1.5067 WP_000968919.1.50690 WP_000968919.1.50700 WP_000968919.1.50715 WP_000968919.1.50717 WP_000968919.1.50728 WP_000968919.1.50762 WP_000968919.1.50925 WP_000968919.1.50936 WP_000968919.1.50939 WP_000968919.1.50947 WP_000968919.1.50986 WP_000968919.1.50988 WP_000968919.1.50990 WP_000968919.1.50993 WP_000968919.1.50996 WP_000968919.1.51027 WP_000968919.1.51042 WP_000968919.1.51058 WP_000968919.1.5106 WP_000968919.1.511 WP_000968919.1.51109 WP_000968919.1.51127 WP_000968919.1.51154 WP_000968919.1.51170 WP_000968919.1.51171 WP_000968919.1.51172 WP_000968919.1.51180 WP_000968919.1.51190 WP_000968919.1.51201 WP_000968919.1.51203 WP_000968919.1.51206 WP_000968919.1.51211 WP_000968919.1.5124 WP_000968919.1.51248 WP_000968919.1.51253 WP_000968919.1.51278 WP_000968919.1.5128 WP_000968919.1.51300 WP_000968919.1.51320 WP_000968919.1.51323 WP_000968919.1.51325 WP_000968919.1.51330 WP_000968919.1.51336 WP_000968919.1.51354 WP_000968919.1.51364 WP_000968919.1.51380 WP_000968919.1.51392 WP_000968919.1.51405 WP_000968919.1.51426 WP_000968919.1.51427 WP_000968919.1.51430 WP_000968919.1.51441 WP_000968919.1.5146 WP_000968919.1.51462 WP_000968919.1.51482 WP_000968919.1.51490 WP_000968919.1.51495 WP_000968919.1.51503 WP_000968919.1.51505 WP_000968919.1.51513 WP_000968919.1.51525 WP_000968919.1.5153 WP_000968919.1.51539 WP_000968919.1.51542 WP_000968919.1.51548 WP_000968919.1.51552 WP_000968919.1.5157 WP_000968919.1.5158 WP_000968919.1.51596 WP_000968919.1.51600 WP_000968919.1.51607 WP_000968919.1.51624 WP_000968919.1.51662 WP_000968919.1.51690 WP_000968919.1.51693 WP_000968919.1.51707 WP_000968919.1.51718 WP_000968919.1.5172 WP_000968919.1.51736 WP_000968919.1.51757 WP_000968919.1.51760 WP_000968919.1.51784 WP_000968919.1.51804 WP_000968919.1.51834 WP_000968919.1.51837 WP_000968919.1.51839 WP_000968919.1.51869 WP_000968919.1.51873 WP_000968919.1.51881 WP_000968919.1.51899 WP_000968919.1.51906 WP_000968919.1.51949 WP_000968919.1.51968 WP_000968919.1.51985 WP_000968919.1.51988 WP_000968919.1.51999 WP_000968919.1.52002 WP_000968919.1.52011 WP_000968919.1.52020 WP_000968919.1.52039 WP_000968919.1.52044 WP_000968919.1.52048 WP_000968919.1.52062 WP_000968919.1.52076 WP_000968919.1.52085 WP_000968919.1.52098 WP_000968919.1.52111 WP_000968919.1.52126 WP_000968919.1.52127 WP_000968919.1.52135 WP_000968919.1.52137 WP_000968919.1.5217 WP_000968919.1.52171 WP_000968919.1.52186 WP_000968919.1.52211 WP_000968919.1.52214 WP_000968919.1.52225 WP_000968919.1.52230 WP_000968919.1.52240 WP_000968919.1.52243 WP_000968919.1.52249 WP_000968919.1.52258 WP_000968919.1.5227 WP_000968919.1.52270 WP_000968919.1.52271 WP_000968919.1.52299 WP_000968919.1.52304 WP_000968919.1.52305 WP_000968919.1.52313 WP_000968919.1.52324 WP_000968919.1.52328 WP_000968919.1.52333 WP_000968919.1.52378 WP_000968919.1.5239 WP_000968919.1.52406 WP_000968919.1.52413 WP_000968919.1.52419 WP_000968919.1.52421 WP_000968919.1.52492 WP_000968919.1.52496 WP_000968919.1.52544 WP_000968919.1.52554 WP_000968919.1.52558 WP_000968919.1.52567 WP_000968919.1.52601 WP_000968919.1.52612 WP_000968919.1.52631 WP_000968919.1.5265 WP_000968919.1.52662 WP_000968919.1.52710 WP_000968919.1.52735 WP_000968919.1.52755 WP_000968919.1.52762 WP_000968919.1.52774 WP_000968919.1.52780 WP_000968919.1.52781 WP_000968919.1.52801 WP_000968919.1.52846 WP_000968919.1.5285 WP_000968919.1.52852 WP_000968919.1.52853 WP_000968919.1.52855 WP_000968919.1.52883 WP_000968919.1.52895 WP_000968919.1.52908 WP_000968919.1.5291 WP_000968919.1.52913 WP_000968919.1.52933 WP_000968919.1.52942 WP_000968919.1.52945 WP_000968919.1.52995 WP_000968919.1.52996 WP_000968919.1.53012 WP_000968919.1.53020 WP_000968919.1.53021 WP_000968919.1.53027 WP_000968919.1.53065 WP_000968919.1.53084 WP_000968919.1.53099 WP_000968919.1.5310 WP_000968919.1.53110 WP_000968919.1.53123 WP_000968919.1.53155 WP_000968919.1.53162 WP_000968919.1.53181 WP_000968919.1.53186 WP_000968919.1.53211 WP_000968919.1.5322 WP_000968919.1.53223 WP_000968919.1.53228 WP_000968919.1.53238 WP_000968919.1.53242 WP_000968919.1.53252 WP_000968919.1.53262 WP_000968919.1.53270 WP_000968919.1.53277 WP_000968919.1.53308 WP_000968919.1.53327 WP_000968919.1.53356 WP_000968919.1.53360 WP_000968919.1.53377 WP_000968919.1.53401 WP_000968919.1.53415 WP_000968919.1.53419 WP_000968919.1.53431 WP_000968919.1.53482 WP_000968919.1.53505 WP_000968919.1.5351 WP_000968919.1.53535 WP_000968919.1.53545 WP_000968919.1.53556 WP_000968919.1.53557 WP_000968919.1.53574 WP_000968919.1.53582 WP_000968919.1.53590 WP_000968919.1.53592 WP_000968919.1.53594 WP_000968919.1.5362 WP_000968919.1.53642 WP_000968919.1.53645 WP_000968919.1.53649 WP_000968919.1.53687 WP_000968919.1.53690 WP_000968919.1.53693 WP_000968919.1.53706 WP_000968919.1.53769 WP_000968919.1.53809 WP_000968919.1.53810 WP_000968919.1.53811 WP_000968919.1.53841 WP_000968919.1.53863 WP_000968919.1.53866 WP_000968919.1.53878 WP_000968919.1.53884 WP_000968919.1.5391 WP_000968919.1.5393 WP_000968919.1.53931 WP_000968919.1.53940 WP_000968919.1.5395 WP_000968919.1.53966 WP_000968919.1.53968 WP_000968919.1.53972 WP_000968919.1.53978 WP_000968919.1.53991 WP_000968919.1.53994 WP_000968919.1.54002 WP_000968919.1.54013 WP_000968919.1.54024 WP_000968919.1.54032 WP_000968919.1.54051 WP_000968919.1.54072 WP_000968919.1.54095 WP_000968919.1.54104 WP_000968919.1.54169 WP_000968919.1.54185 WP_000968919.1.54188 WP_000968919.1.54202 WP_000968919.1.54208 WP_000968919.1.54213 WP_000968919.1.54307 WP_000968919.1.54313 WP_000968919.1.54317 WP_000968919.1.54328 WP_000968919.1.54329 WP_000968919.1.5433 WP_000968919.1.5434 WP_000968919.1.54344 WP_000968919.1.54359 WP_000968919.1.5440 WP_000968919.1.5441 WP_000968919.1.54417 WP_000968919.1.54418 WP_000968919.1.54429 WP_000968919.1.54439 WP_000968919.1.54454 WP_000968919.1.54463 WP_000968919.1.54476 WP_000968919.1.54507 WP_000968919.1.54524 WP_000968919.1.54534 WP_000968919.1.54546 WP_000968919.1.54590 WP_000968919.1.54591 WP_000968919.1.5460 WP_000968919.1.54602 WP_000968919.1.54605 WP_000968919.1.5461 WP_000968919.1.54614 WP_000968919.1.54617 WP_000968919.1.54620 WP_000968919.1.54638 WP_000968919.1.54641 WP_000968919.1.5467 WP_000968919.1.54688 WP_000968919.1.54695 WP_000968919.1.5470 WP_000968919.1.54708 WP_000968919.1.54725 WP_000968919.1.54729 WP_000968919.1.54754 WP_000968919.1.54755 WP_000968919.1.54769 WP_000968919.1.5478 WP_000968919.1.5479 WP_000968919.1.54798 WP_000968919.1.54817 WP_000968919.1.54829 WP_000968919.1.54883 WP_000968919.1.54918 WP_000968919.1.54921 WP_000968919.1.54927 WP_000968919.1.54940 WP_000968919.1.54941 WP_000968919.1.54946 WP_000968919.1.54972 WP_000968919.1.54981 WP_000968919.1.54989 WP_000968919.1.54991 WP_000968919.1.54993 WP_000968919.1.55003 WP_000968919.1.55005 WP_000968919.1.55009 WP_000968919.1.55041 WP_000968919.1.55070 WP_000968919.1.55112 WP_000968919.1.55115 WP_000968919.1.55123 WP_000968919.1.55134 WP_000968919.1.55144 WP_000968919.1.55149 WP_000968919.1.55151 WP_000968919.1.55177 WP_000968919.1.5520 WP_000968919.1.55203 WP_000968919.1.55218 WP_000968919.1.55222 WP_000968919.1.55275 WP_000968919.1.55286 WP_000968919.1.55291 WP_000968919.1.55338 WP_000968919.1.55342 WP_000968919.1.55357 WP_000968919.1.55359 WP_000968919.1.55374 WP_000968919.1.55381 WP_000968919.1.55420 WP_000968919.1.55425 WP_000968919.1.5546 WP_000968919.1.55466 WP_000968919.1.55472 WP_000968919.1.55482 WP_000968919.1.55483 WP_000968919.1.55489 WP_000968919.1.55492 WP_000968919.1.55507 WP_000968919.1.55529 WP_000968919.1.55551 WP_000968919.1.55552 WP_000968919.1.55556 WP_000968919.1.55560 WP_000968919.1.55563 WP_000968919.1.55571 WP_000968919.1.55574 WP_000968919.1.55581 WP_000968919.1.55597 WP_000968919.1.55608 WP_000968919.1.55629 WP_000968919.1.5566 WP_000968919.1.55676 WP_000968919.1.5570 WP_000968919.1.55709 WP_000968919.1.55720 WP_000968919.1.55727 WP_000968919.1.55730 WP_000968919.1.55731 WP_000968919.1.55744 WP_000968919.1.55790 WP_000968919.1.55791 WP_000968919.1.55808 WP_000968919.1.55820 WP_000968919.1.55825 WP_000968919.1.55838 WP_000968919.1.55868 WP_000968919.1.55888 WP_000968919.1.55892 WP_000968919.1.55896 WP_000968919.1.55897 WP_000968919.1.55936 WP_000968919.1.55979 WP_000968919.1.55981 WP_000968919.1.55990 WP_000968919.1.56033 WP_000968919.1.56040 WP_000968919.1.56047 WP_000968919.1.56072 WP_000968919.1.56101 WP_000968919.1.56122 WP_000968919.1.56139 WP_000968919.1.5614 WP_000968919.1.56142 WP_000968919.1.56151 WP_000968919.1.5616 WP_000968919.1.56164 WP_000968919.1.56169 WP_000968919.1.56177 WP_000968919.1.56193 WP_000968919.1.56197 WP_000968919.1.562 WP_000968919.1.56216 WP_000968919.1.56231 WP_000968919.1.56278 WP_000968919.1.56285 WP_000968919.1.56302 WP_000968919.1.5632 WP_000968919.1.56338 WP_000968919.1.56345 WP_000968919.1.56358 WP_000968919.1.56371 WP_000968919.1.56388 WP_000968919.1.5639 WP_000968919.1.56390 WP_000968919.1.56392 WP_000968919.1.56399 WP_000968919.1.56402 WP_000968919.1.56439 WP_000968919.1.56446 WP_000968919.1.56457 WP_000968919.1.56469 WP_000968919.1.56481 WP_000968919.1.56489 WP_000968919.1.5649 WP_000968919.1.56491 WP_000968919.1.56501 WP_000968919.1.56502 WP_000968919.1.56513 WP_000968919.1.56523 WP_000968919.1.56528 WP_000968919.1.56543 WP_000968919.1.56554 WP_000968919.1.56571 WP_000968919.1.56573 WP_000968919.1.56586 WP_000968919.1.56662 WP_000968919.1.56680 WP_000968919.1.56704 WP_000968919.1.56713 WP_000968919.1.56714 WP_000968919.1.56721 WP_000968919.1.56742 WP_000968919.1.56776 WP_000968919.1.56777 WP_000968919.1.56786 WP_000968919.1.56787 WP_000968919.1.56789 WP_000968919.1.56799 WP_000968919.1.56821 WP_000968919.1.56846 WP_000968919.1.5685 WP_000968919.1.56871 WP_000968919.1.56882 WP_000968919.1.56885 WP_000968919.1.56908 WP_000968919.1.56932 WP_000968919.1.56933 WP_000968919.1.56934 WP_000968919.1.56936 WP_000968919.1.56937 WP_000968919.1.56941 WP_000968919.1.56951 WP_000968919.1.56980 WP_000968919.1.56992 WP_000968919.1.57011 WP_000968919.1.57032 WP_000968919.1.57045 WP_000968919.1.57051 WP_000968919.1.57068 WP_000968919.1.57071 WP_000968919.1.57079 WP_000968919.1.57100 WP_000968919.1.57124 WP_000968919.1.57150 WP_000968919.1.57159 WP_000968919.1.57180 WP_000968919.1.57181 WP_000968919.1.57185 WP_000968919.1.57197 WP_000968919.1.57202 WP_000968919.1.57213 WP_000968919.1.57216 WP_000968919.1.57222 WP_000968919.1.57254 WP_000968919.1.57266 WP_000968919.1.57269 WP_000968919.1.57278 WP_000968919.1.57280 WP_000968919.1.57319 WP_000968919.1.57348 WP_000968919.1.57386 WP_000968919.1.57395 WP_000968919.1.57401 WP_000968919.1.57403 WP_000968919.1.57410 WP_000968919.1.57414 WP_000968919.1.5742 WP_000968919.1.57432 WP_000968919.1.57438 WP_000968919.1.57451 WP_000968919.1.57453 WP_000968919.1.57466 WP_000968919.1.5748 WP_000968919.1.57487 WP_000968919.1.57492 WP_000968919.1.57517 WP_000968919.1.57538 WP_000968919.1.57539 WP_000968919.1.5755 WP_000968919.1.57550 WP_000968919.1.57574 WP_000968919.1.57588 WP_000968919.1.57608 WP_000968919.1.57610 WP_000968919.1.57628 WP_000968919.1.57629 WP_000968919.1.57634 WP_000968919.1.57638 WP_000968919.1.5764 WP_000968919.1.57646 WP_000968919.1.57663 WP_000968919.1.57669 WP_000968919.1.57719 WP_000968919.1.57738 WP_000968919.1.57812 WP_000968919.1.57814 WP_000968919.1.57832 WP_000968919.1.57836 WP_000968919.1.57846 WP_000968919.1.5786 WP_000968919.1.5787 WP_000968919.1.57898 WP_000968919.1.57903 WP_000968919.1.57904 WP_000968919.1.57920 WP_000968919.1.57951 WP_000968919.1.57975 WP_000968919.1.57982 WP_000968919.1.58038 WP_000968919.1.58045 WP_000968919.1.58048 WP_000968919.1.58057 WP_000968919.1.58060 WP_000968919.1.58080 WP_000968919.1.58092 WP_000968919.1.58094 WP_000968919.1.58097 WP_000968919.1.5810 WP_000968919.1.58136 WP_000968919.1.58143 WP_000968919.1.58146 WP_000968919.1.58163 WP_000968919.1.58169 WP_000968919.1.58172 WP_000968919.1.58206 WP_000968919.1.58226 WP_000968919.1.58232 WP_000968919.1.58233 WP_000968919.1.58238 WP_000968919.1.58248 WP_000968919.1.58267 WP_000968919.1.58289 WP_000968919.1.58292 WP_000968919.1.58316 WP_000968919.1.58336 WP_000968919.1.58340 WP_000968919.1.58345 WP_000968919.1.58368 WP_000968919.1.58371 WP_000968919.1.58384 WP_000968919.1.584 WP_000968919.1.58401 WP_000968919.1.58408 WP_000968919.1.58414 WP_000968919.1.5842 WP_000968919.1.58420 WP_000968919.1.58423 WP_000968919.1.58429 WP_000968919.1.58440 WP_000968919.1.58444 WP_000968919.1.58445 WP_000968919.1.58449 WP_000968919.1.58475 WP_000968919.1.58484 WP_000968919.1.58493 WP_000968919.1.585 WP_000968919.1.58514 WP_000968919.1.5852 WP_000968919.1.58528 WP_000968919.1.58547 WP_000968919.1.58552 WP_000968919.1.58572 WP_000968919.1.58582 WP_000968919.1.58609 WP_000968919.1.58617 WP_000968919.1.58622 WP_000968919.1.58680 WP_000968919.1.58692 WP_000968919.1.58707 WP_000968919.1.58723 WP_000968919.1.58737 WP_000968919.1.58867 WP_000968919.1.58870 WP_000968919.1.58901 WP_000968919.1.58940 WP_000968919.1.58942 WP_000968919.1.58951 WP_000968919.1.58958 WP_000968919.1.58976 WP_000968919.1.58983 WP_000968919.1.59024 WP_000968919.1.59026 WP_000968919.1.59035 WP_000968919.1.59038 WP_000968919.1.59055 WP_000968919.1.5906 WP_000968919.1.59060 WP_000968919.1.59073 WP_000968919.1.59083 WP_000968919.1.59119 WP_000968919.1.59165 WP_000968919.1.59190 WP_000968919.1.59199 WP_000968919.1.59218 WP_000968919.1.59226 WP_000968919.1.59263 WP_000968919.1.59280 WP_000968919.1.59292 WP_000968919.1.59293 WP_000968919.1.59302 WP_000968919.1.59306 WP_000968919.1.59359 WP_000968919.1.59374 WP_000968919.1.59395 WP_000968919.1.59396 WP_000968919.1.59407 WP_000968919.1.59409 WP_000968919.1.5942 WP_000968919.1.59423 WP_000968919.1.59425 WP_000968919.1.59426 WP_000968919.1.59434 WP_000968919.1.59470 WP_000968919.1.59483 WP_000968919.1.59491 WP_000968919.1.59513 WP_000968919.1.59553 WP_000968919.1.59572 WP_000968919.1.59577 WP_000968919.1.59579 WP_000968919.1.59590 WP_000968919.1.59611 WP_000968919.1.59615 WP_000968919.1.59621 WP_000968919.1.5963 WP_000968919.1.59638 WP_000968919.1.5965 WP_000968919.1.59660 WP_000968919.1.59679 WP_000968919.1.59689 WP_000968919.1.597 WP_000968919.1.59717 WP_000968919.1.59733 WP_000968919.1.59737 WP_000968919.1.59745 WP_000968919.1.59782 WP_000968919.1.59791 WP_000968919.1.59793 WP_000968919.1.59815 WP_000968919.1.59823 WP_000968919.1.59836 WP_000968919.1.59838 WP_000968919.1.59853 WP_000968919.1.59855 WP_000968919.1.59858 WP_000968919.1.5990 WP_000968919.1.59905 WP_000968919.1.59912 WP_000968919.1.59914 WP_000968919.1.59931 WP_000968919.1.59932 WP_000968919.1.59959 WP_000968919.1.59970 WP_000968919.1.59980 WP_000968919.1.59998 WP_000968919.1.60005 WP_000968919.1.6002 WP_000968919.1.60023 WP_000968919.1.60042 WP_000968919.1.60043 WP_000968919.1.60048 WP_000968919.1.60067 WP_000968919.1.60070 WP_000968919.1.60095 WP_000968919.1.60096 WP_000968919.1.60110 WP_000968919.1.60117 WP_000968919.1.6013 WP_000968919.1.60133 WP_000968919.1.60151 WP_000968919.1.60186 WP_000968919.1.6022 WP_000968919.1.60225 WP_000968919.1.60228 WP_000968919.1.60235 WP_000968919.1.60246 WP_000968919.1.60304 WP_000968919.1.60342 WP_000968919.1.60343 WP_000968919.1.60350 WP_000968919.1.60373 WP_000968919.1.60374 WP_000968919.1.60387 WP_000968919.1.60411 WP_000968919.1.60443 WP_000968919.1.60457 WP_000968919.1.60461 WP_000968919.1.60477 WP_000968919.1.60491 WP_000968919.1.60505 WP_000968919.1.60544 WP_000968919.1.60550 WP_000968919.1.60555 WP_000968919.1.60559 WP_000968919.1.60570 WP_000968919.1.60576 WP_000968919.1.60599 WP_000968919.1.60606 WP_000968919.1.6061 WP_000968919.1.60613 WP_000968919.1.60614 WP_000968919.1.6064 WP_000968919.1.60644 WP_000968919.1.60647 WP_000968919.1.60654 WP_000968919.1.6066 WP_000968919.1.60671 WP_000968919.1.60684 WP_000968919.1.60698 WP_000968919.1.60717 WP_000968919.1.60732 WP_000968919.1.60744 WP_000968919.1.60761 WP_000968919.1.60764 WP_000968919.1.60771 WP_000968919.1.60805 WP_000968919.1.60816 WP_000968919.1.60826 WP_000968919.1.60832 WP_000968919.1.60847 WP_000968919.1.60872 WP_000968919.1.60895 WP_000968919.1.60901 WP_000968919.1.60921 WP_000968919.1.60925 WP_000968919.1.60927 WP_000968919.1.6094 WP_000968919.1.60974 WP_000968919.1.61005 WP_000968919.1.61008 WP_000968919.1.61035 WP_000968919.1.61039 WP_000968919.1.61046 WP_000968919.1.61058 WP_000968919.1.6106 WP_000968919.1.61096 WP_000968919.1.61097 WP_000968919.1.61099 WP_000968919.1.61108 WP_000968919.1.61121 WP_000968919.1.61148 WP_000968919.1.61170 WP_000968919.1.61175 WP_000968919.1.61181 WP_000968919.1.61186 WP_000968919.1.61223 WP_000968919.1.61225 WP_000968919.1.61241 WP_000968919.1.61245 WP_000968919.1.61253 WP_000968919.1.61268 WP_000968919.1.61284 WP_000968919.1.61292 WP_000968919.1.61360 WP_000968919.1.61362 WP_000968919.1.61373 WP_000968919.1.61398 WP_000968919.1.61445 WP_000968919.1.61496 WP_000968919.1.615 WP_000968919.1.61505 WP_000968919.1.61512 WP_000968919.1.61517 WP_000968919.1.61524 WP_000968919.1.61608 WP_000968919.1.61612 WP_000968919.1.61617 WP_000968919.1.61623 WP_000968919.1.61636 WP_000968919.1.61643 WP_000968919.1.61663 WP_000968919.1.61703 WP_000968919.1.61718 WP_000968919.1.61739 WP_000968919.1.61758 WP_000968919.1.61770 WP_000968919.1.61772 WP_000968919.1.61779 WP_000968919.1.61789 WP_000968919.1.618 WP_000968919.1.61806 WP_000968919.1.61822 WP_000968919.1.61835 WP_000968919.1.61853 WP_000968919.1.61858 WP_000968919.1.61874 WP_000968919.1.61893 WP_000968919.1.61926 WP_000968919.1.61948 WP_000968919.1.61949 WP_000968919.1.61955 WP_000968919.1.61966 WP_000968919.1.62041 WP_000968919.1.62091 WP_000968919.1.62099 WP_000968919.1.62102 WP_000968919.1.6212 WP_000968919.1.62135 WP_000968919.1.62157 WP_000968919.1.62182 WP_000968919.1.62207 WP_000968919.1.62262 WP_000968919.1.62264 WP_000968919.1.62273 WP_000968919.1.62290 WP_000968919.1.62303 WP_000968919.1.62322 WP_000968919.1.62348 WP_000968919.1.62358 WP_000968919.1.62424 WP_000968919.1.62447 WP_000968919.1.6245 WP_000968919.1.62454 WP_000968919.1.62460 WP_000968919.1.62480 WP_000968919.1.62481 WP_000968919.1.62487 WP_000968919.1.62503 WP_000968919.1.62507 WP_000968919.1.62513 WP_000968919.1.62541 WP_000968919.1.62555 WP_000968919.1.62586 WP_000968919.1.6261 WP_000968919.1.62612 WP_000968919.1.62642 WP_000968919.1.62646 WP_000968919.1.62668 WP_000968919.1.62675 WP_000968919.1.62681 WP_000968919.1.62714 WP_000968919.1.62735 WP_000968919.1.62750 WP_000968919.1.62769 WP_000968919.1.62780 WP_000968919.1.62784 WP_000968919.1.62787 WP_000968919.1.62788 WP_000968919.1.62802 WP_000968919.1.62812 WP_000968919.1.62818 WP_000968919.1.62840 WP_000968919.1.62843 WP_000968919.1.62850 WP_000968919.1.62885 WP_000968919.1.62888 WP_000968919.1.62914 WP_000968919.1.62931 WP_000968919.1.62959 WP_000968919.1.62973 WP_000968919.1.62989 WP_000968919.1.62992 WP_000968919.1.63023 WP_000968919.1.63078 WP_000968919.1.63167 WP_000968919.1.63177 WP_000968919.1.63189 WP_000968919.1.6323 WP_000968919.1.63246 WP_000968919.1.63285 WP_000968919.1.63287 WP_000968919.1.63305 WP_000968919.1.6331 WP_000968919.1.63310 WP_000968919.1.63330 WP_000968919.1.6334 WP_000968919.1.63350 WP_000968919.1.6337 WP_000968919.1.63370 WP_000968919.1.63393 WP_000968919.1.63419 WP_000968919.1.63433 WP_000968919.1.63435 WP_000968919.1.63445 WP_000968919.1.63453 WP_000968919.1.63465 WP_000968919.1.63466 WP_000968919.1.63467 WP_000968919.1.63470 WP_000968919.1.63478 WP_000968919.1.6348 WP_000968919.1.63484 WP_000968919.1.63491 WP_000968919.1.63496 WP_000968919.1.63536 WP_000968919.1.63554 WP_000968919.1.63563 WP_000968919.1.63576 WP_000968919.1.63586 WP_000968919.1.63602 WP_000968919.1.63612 WP_000968919.1.63615 WP_000968919.1.6364 WP_000968919.1.63666 WP_000968919.1.63679 WP_000968919.1.63683 WP_000968919.1.63703 WP_000968919.1.63721 WP_000968919.1.63746 WP_000968919.1.63800 WP_000968919.1.63810 WP_000968919.1.63821 WP_000968919.1.63856 WP_000968919.1.63871 WP_000968919.1.63872 WP_000968919.1.63944 WP_000968919.1.63957 WP_000968919.1.63964 WP_000968919.1.63990 WP_000968919.1.64008 WP_000968919.1.64030 WP_000968919.1.64040 WP_000968919.1.64045 WP_000968919.1.64053 WP_000968919.1.64080 WP_000968919.1.64086 WP_000968919.1.64110 WP_000968919.1.64138 WP_000968919.1.64150 WP_000968919.1.64153 WP_000968919.1.6416 WP_000968919.1.64161 WP_000968919.1.64165 WP_000968919.1.64175 WP_000968919.1.64180 WP_000968919.1.64190 WP_000968919.1.64193 WP_000968919.1.64280 WP_000968919.1.64285 WP_000968919.1.64286 WP_000968919.1.643 WP_000968919.1.6431 WP_000968919.1.64337 WP_000968919.1.64353 WP_000968919.1.64355 WP_000968919.1.64371 WP_000968919.1.64380 WP_000968919.1.64391 WP_000968919.1.6441 WP_000968919.1.64417 WP_000968919.1.64437 WP_000968919.1.64438 WP_000968919.1.6444 WP_000968919.1.64448 WP_000968919.1.6445 WP_000968919.1.64458 WP_000968919.1.64519 WP_000968919.1.64540 WP_000968919.1.64547 WP_000968919.1.64563 WP_000968919.1.64621 WP_000968919.1.64634 WP_000968919.1.64657 WP_000968919.1.64670 WP_000968919.1.6469 WP_000968919.1.64693 WP_000968919.1.647 WP_000968919.1.64712 WP_000968919.1.64746 WP_000968919.1.64749 WP_000968919.1.64784 WP_000968919.1.64789 WP_000968919.1.64793 WP_000968919.1.64821 WP_000968919.1.64840 WP_000968919.1.64881 WP_000968919.1.64895 WP_000968919.1.64912 WP_000968919.1.64926 WP_000968919.1.64930 WP_000968919.1.64939 WP_000968919.1.64946 WP_000968919.1.64970 WP_000968919.1.6499 WP_000968919.1.64990 WP_000968919.1.6500 WP_000968919.1.65023 WP_000968919.1.65035 WP_000968919.1.65040 WP_000968919.1.65061 WP_000968919.1.65084 WP_000968919.1.65097 WP_000968919.1.651 WP_000968919.1.65104 WP_000968919.1.6511 WP_000968919.1.65110 WP_000968919.1.65114 WP_000968919.1.65116 WP_000968919.1.65118 WP_000968919.1.65122 WP_000968919.1.65135 WP_000968919.1.65151 WP_000968919.1.65155 WP_000968919.1.6516 WP_000968919.1.65179 WP_000968919.1.65192 WP_000968919.1.65194 WP_000968919.1.65206 WP_000968919.1.65240 WP_000968919.1.65256 WP_000968919.1.6527 WP_000968919.1.65271 WP_000968919.1.65286 WP_000968919.1.65296 WP_000968919.1.65305 WP_000968919.1.65353 WP_000968919.1.65364 WP_000968919.1.65366 WP_000968919.1.6537 WP_000968919.1.65370 WP_000968919.1.65372 WP_000968919.1.65408 WP_000968919.1.65413 WP_000968919.1.65415 WP_000968919.1.65456 WP_000968919.1.65484 WP_000968919.1.65493 WP_000968919.1.6553 WP_000968919.1.65531 WP_000968919.1.65546 WP_000968919.1.65565 WP_000968919.1.65571 WP_000968919.1.65581 WP_000968919.1.65596 WP_000968919.1.65606 WP_000968919.1.6563 WP_000968919.1.65662 WP_000968919.1.65667 WP_000968919.1.65672 WP_000968919.1.65677 WP_000968919.1.65708 WP_000968919.1.65714 WP_000968919.1.65749 WP_000968919.1.6576 WP_000968919.1.65762 WP_000968919.1.65834 WP_000968919.1.6587 WP_000968919.1.65875 WP_000968919.1.65898 WP_000968919.1.65912 WP_000968919.1.65954 WP_000968919.1.65957 WP_000968919.1.65961 WP_000968919.1.65963 WP_000968919.1.65978 WP_000968919.1.65988 WP_000968919.1.6599 WP_000968919.1.65991 WP_000968919.1.66007 WP_000968919.1.66016 WP_000968919.1.66017 WP_000968919.1.66022 WP_000968919.1.66033 WP_000968919.1.6604 WP_000968919.1.66044 WP_000968919.1.66050 WP_000968919.1.66059 WP_000968919.1.6609 WP_000968919.1.66100 WP_000968919.1.66102 WP_000968919.1.66104 WP_000968919.1.66105 WP_000968919.1.66121 WP_000968919.1.66127 WP_000968919.1.66161 WP_000968919.1.6618 WP_000968919.1.66181 WP_000968919.1.66187 WP_000968919.1.6622 WP_000968919.1.66251 WP_000968919.1.66264 WP_000968919.1.66280 WP_000968919.1.66290 WP_000968919.1.66295 WP_000968919.1.66327 WP_000968919.1.66335 WP_000968919.1.6635 WP_000968919.1.66376 WP_000968919.1.66387 WP_000968919.1.66389 WP_000968919.1.66392 WP_000968919.1.66395 WP_000968919.1.66412 WP_000968919.1.66432 WP_000968919.1.6645 WP_000968919.1.66501 WP_000968919.1.66511 WP_000968919.1.66523 WP_000968919.1.66531 WP_000968919.1.66559 WP_000968919.1.66566 WP_000968919.1.66579 WP_000968919.1.66624 WP_000968919.1.6665 WP_000968919.1.6666 WP_000968919.1.66667 WP_000968919.1.66700 WP_000968919.1.66706 WP_000968919.1.66708 WP_000968919.1.66719 WP_000968919.1.66727 WP_000968919.1.66758 WP_000968919.1.6676 WP_000968919.1.66783 WP_000968919.1.66787 WP_000968919.1.66791 WP_000968919.1.66795 WP_000968919.1.66796 WP_000968919.1.66849 WP_000968919.1.66873 WP_000968919.1.66922 WP_000968919.1.66926 WP_000968919.1.66933 WP_000968919.1.66948 WP_000968919.1.66975 WP_000968919.1.66978 WP_000968919.1.6698 WP_000968919.1.6701 WP_000968919.1.67021 WP_000968919.1.67022 WP_000968919.1.67026 WP_000968919.1.67029 WP_000968919.1.67047 WP_000968919.1.6706 WP_000968919.1.67073 WP_000968919.1.67116 WP_000968919.1.67120 WP_000968919.1.67132 WP_000968919.1.67136 WP_000968919.1.67149 WP_000968919.1.67150 WP_000968919.1.67153 WP_000968919.1.67158 WP_000968919.1.67164 WP_000968919.1.67174 WP_000968919.1.67193 WP_000968919.1.67194 WP_000968919.1.67200 WP_000968919.1.67209 WP_000968919.1.67210 WP_000968919.1.67214 WP_000968919.1.6723 WP_000968919.1.67258 WP_000968919.1.67272 WP_000968919.1.6735 WP_000968919.1.67412 WP_000968919.1.67415 WP_000968919.1.67427 WP_000968919.1.67446 WP_000968919.1.67451 WP_000968919.1.67452 WP_000968919.1.67456 WP_000968919.1.67462 WP_000968919.1.67464 WP_000968919.1.67467 WP_000968919.1.67468 WP_000968919.1.67533 WP_000968919.1.67538 WP_000968919.1.67549 WP_000968919.1.67553 WP_000968919.1.67590 WP_000968919.1.67606 WP_000968919.1.67663 WP_000968919.1.67669 WP_000968919.1.67676 WP_000968919.1.67681 WP_000968919.1.67685 WP_000968919.1.6769 WP_000968919.1.67690 WP_000968919.1.67704 WP_000968919.1.67726 WP_000968919.1.67737 WP_000968919.1.67753 WP_000968919.1.67758 WP_000968919.1.67760 WP_000968919.1.67775 WP_000968919.1.67780 WP_000968919.1.67786 WP_000968919.1.67787 WP_000968919.1.67788 WP_000968919.1.678 WP_000968919.1.67802 WP_000968919.1.67810 WP_000968919.1.67841 WP_000968919.1.67853 WP_000968919.1.67861 WP_000968919.1.67891 WP_000968919.1.67901 WP_000968919.1.6793 WP_000968919.1.67938 WP_000968919.1.67971 WP_000968919.1.67975 WP_000968919.1.67984 WP_000968919.1.67990 WP_000968919.1.68008 WP_000968919.1.68011 WP_000968919.1.68012 WP_000968919.1.6802 WP_000968919.1.6803 WP_000968919.1.68039 WP_000968919.1.68052 WP_000968919.1.68053 WP_000968919.1.68059 WP_000968919.1.68063 WP_000968919.1.68069 WP_000968919.1.68070 WP_000968919.1.68071 WP_000968919.1.68096 WP_000968919.1.68108 WP_000968919.1.68126 WP_000968919.1.68138 WP_000968919.1.6814 WP_000968919.1.68145 WP_000968919.1.68157 WP_000968919.1.68170 WP_000968919.1.68175 WP_000968919.1.68177 WP_000968919.1.682 WP_000968919.1.68215 WP_000968919.1.68241 WP_000968919.1.68255 WP_000968919.1.68278 WP_000968919.1.68279 WP_000968919.1.68281 WP_000968919.1.68283 WP_000968919.1.68292 WP_000968919.1.68336 WP_000968919.1.68341 WP_000968919.1.68347 WP_000968919.1.68362 WP_000968919.1.68369 WP_000968919.1.68372 WP_000968919.1.68395 WP_000968919.1.68396 WP_000968919.1.68411 WP_000968919.1.68441 WP_000968919.1.68442 WP_000968919.1.68482 WP_000968919.1.68490 WP_000968919.1.68493 WP_000968919.1.68523 WP_000968919.1.68524 WP_000968919.1.68534 WP_000968919.1.68566 WP_000968919.1.68572 WP_000968919.1.68584 WP_000968919.1.68598 WP_000968919.1.68609 WP_000968919.1.68630 WP_000968919.1.68632 WP_000968919.1.68635 WP_000968919.1.68673 WP_000968919.1.68678 WP_000968919.1.68679 WP_000968919.1.68695 WP_000968919.1.68697 WP_000968919.1.68701 WP_000968919.1.68711 WP_000968919.1.68750 WP_000968919.1.68751 WP_000968919.1.68752 WP_000968919.1.68793 WP_000968919.1.68795 WP_000968919.1.68797 WP_000968919.1.6880 WP_000968919.1.68801 WP_000968919.1.68838 WP_000968919.1.68847 WP_000968919.1.68865 WP_000968919.1.6887 WP_000968919.1.68873 WP_000968919.1.68880 WP_000968919.1.68915 WP_000968919.1.6892 WP_000968919.1.68936 WP_000968919.1.68942 WP_000968919.1.68952 WP_000968919.1.68956 WP_000968919.1.68961 WP_000968919.1.6897 WP_000968919.1.68989 WP_000968919.1.68995 WP_000968919.1.69033 WP_000968919.1.69039 WP_000968919.1.69054 WP_000968919.1.69126 WP_000968919.1.69127 WP_000968919.1.69144 WP_000968919.1.69158 WP_000968919.1.6916 WP_000968919.1.69160 WP_000968919.1.6919 WP_000968919.1.69192 WP_000968919.1.6921 WP_000968919.1.6923 WP_000968919.1.69247 WP_000968919.1.69261 WP_000968919.1.6929 WP_000968919.1.69303 WP_000968919.1.69305 WP_000968919.1.69341 WP_000968919.1.69350 WP_000968919.1.69351 WP_000968919.1.69382 WP_000968919.1.694 WP_000968919.1.69404 WP_000968919.1.69441 WP_000968919.1.6945 WP_000968919.1.69450 WP_000968919.1.69473 WP_000968919.1.69506 WP_000968919.1.69537 WP_000968919.1.69551 WP_000968919.1.69569 WP_000968919.1.69583 WP_000968919.1.69589 WP_000968919.1.69596 WP_000968919.1.69605 WP_000968919.1.69643 WP_000968919.1.69646 WP_000968919.1.69649 WP_000968919.1.69655 WP_000968919.1.69689 WP_000968919.1.697 WP_000968919.1.69716 WP_000968919.1.69730 WP_000968919.1.69735 WP_000968919.1.69780 WP_000968919.1.69786 WP_000968919.1.69803 WP_000968919.1.69810 WP_000968919.1.69818 WP_000968919.1.69831 WP_000968919.1.69832 WP_000968919.1.69868 WP_000968919.1.69872 WP_000968919.1.69887 WP_000968919.1.69896 WP_000968919.1.69963 WP_000968919.1.69972 WP_000968919.1.69979 WP_000968919.1.69999 WP_000968919.1.7001 WP_000968919.1.70063 WP_000968919.1.70081 WP_000968919.1.701 WP_000968919.1.70123 WP_000968919.1.70125 WP_000968919.1.7013 WP_000968919.1.70149 WP_000968919.1.7015 WP_000968919.1.70190 WP_000968919.1.70191 WP_000968919.1.70200 WP_000968919.1.70213 WP_000968919.1.70230 WP_000968919.1.70251 WP_000968919.1.70256 WP_000968919.1.70299 WP_000968919.1.70337 WP_000968919.1.70341 WP_000968919.1.70407 WP_000968919.1.70414 WP_000968919.1.70477 WP_000968919.1.70492 WP_000968919.1.7050 WP_000968919.1.70509 WP_000968919.1.70517 WP_000968919.1.7052 WP_000968919.1.70530 WP_000968919.1.70539 WP_000968919.1.70563 WP_000968919.1.70576 WP_000968919.1.70582 WP_000968919.1.70592 WP_000968919.1.70600 WP_000968919.1.70619 WP_000968919.1.70656 WP_000968919.1.70686 WP_000968919.1.70694 WP_000968919.1.70698 WP_000968919.1.70705 WP_000968919.1.70713 WP_000968919.1.70723 WP_000968919.1.70728 WP_000968919.1.70745 WP_000968919.1.70747 WP_000968919.1.70748 WP_000968919.1.70767 WP_000968919.1.70787 WP_000968919.1.70794 WP_000968919.1.70803 WP_000968919.1.70900 WP_000968919.1.70952 WP_000968919.1.70967 WP_000968919.1.71003 WP_000968919.1.7102 WP_000968919.1.71024 WP_000968919.1.71037 WP_000968919.1.71042 WP_000968919.1.71062 WP_000968919.1.71099 WP_000968919.1.71113 WP_000968919.1.71139 WP_000968919.1.71144 WP_000968919.1.71158 WP_000968919.1.71159 WP_000968919.1.71162 WP_000968919.1.71170 WP_000968919.1.71176 WP_000968919.1.71183 WP_000968919.1.71192 WP_000968919.1.71199 WP_000968919.1.71205 WP_000968919.1.7121 WP_000968919.1.71221 WP_000968919.1.71223 WP_000968919.1.71225 WP_000968919.1.71226 WP_000968919.1.71229 WP_000968919.1.71264 WP_000968919.1.71269 WP_000968919.1.71272 WP_000968919.1.71273 WP_000968919.1.71285 WP_000968919.1.71287 WP_000968919.1.71294 WP_000968919.1.71311 WP_000968919.1.71312 WP_000968919.1.71323 WP_000968919.1.71354 WP_000968919.1.71397 WP_000968919.1.71403 WP_000968919.1.71405 WP_000968919.1.71409 WP_000968919.1.71423 WP_000968919.1.71448 WP_000968919.1.7147 WP_000968919.1.71480 WP_000968919.1.71522 WP_000968919.1.71533 WP_000968919.1.71537 WP_000968919.1.71538 WP_000968919.1.71540 WP_000968919.1.71560 WP_000968919.1.71563 WP_000968919.1.71603 WP_000968919.1.71632 WP_000968919.1.71680 WP_000968919.1.71690 WP_000968919.1.71695 WP_000968919.1.71712 WP_000968919.1.71724 WP_000968919.1.71732 WP_000968919.1.71783 WP_000968919.1.71830 WP_000968919.1.71832 WP_000968919.1.71837 WP_000968919.1.71840 WP_000968919.1.71855 WP_000968919.1.71856 WP_000968919.1.71874 WP_000968919.1.71912 WP_000968919.1.7192 WP_000968919.1.71922 WP_000968919.1.71938 WP_000968919.1.71940 WP_000968919.1.71944 WP_000968919.1.71945 WP_000968919.1.71967 WP_000968919.1.71975 WP_000968919.1.71987 WP_000968919.1.71993 WP_000968919.1.72013 WP_000968919.1.72016 WP_000968919.1.72021 WP_000968919.1.72028 WP_000968919.1.72033 WP_000968919.1.72053 WP_000968919.1.72054 WP_000968919.1.72066 WP_000968919.1.72090 WP_000968919.1.72098 WP_000968919.1.7210 WP_000968919.1.72117 WP_000968919.1.72120 WP_000968919.1.72125 WP_000968919.1.72126 WP_000968919.1.72141 WP_000968919.1.72153 WP_000968919.1.72155 WP_000968919.1.72157 WP_000968919.1.72162 WP_000968919.1.72180 WP_000968919.1.72184 WP_000968919.1.72208 WP_000968919.1.72212 WP_000968919.1.72237 WP_000968919.1.72240 WP_000968919.1.72258 WP_000968919.1.72262 WP_000968919.1.72270 WP_000968919.1.72279 WP_000968919.1.72290 WP_000968919.1.72293 WP_000968919.1.72298 WP_000968919.1.723 WP_000968919.1.72316 WP_000968919.1.72322 WP_000968919.1.72337 WP_000968919.1.72342 WP_000968919.1.72359 WP_000968919.1.72362 WP_000968919.1.72388 WP_000968919.1.72391 WP_000968919.1.72392 WP_000968919.1.72397 WP_000968919.1.72414 WP_000968919.1.72425 WP_000968919.1.72427 WP_000968919.1.72431 WP_000968919.1.72436 WP_000968919.1.72449 WP_000968919.1.72469 WP_000968919.1.72485 WP_000968919.1.72493 WP_000968919.1.72521 WP_000968919.1.72535 WP_000968919.1.72537 WP_000968919.1.72544 WP_000968919.1.72574 WP_000968919.1.72582 WP_000968919.1.72593 WP_000968919.1.72599 WP_000968919.1.72606 WP_000968919.1.72608 WP_000968919.1.72614 WP_000968919.1.72615 WP_000968919.1.72616 WP_000968919.1.72641 WP_000968919.1.72643 WP_000968919.1.72651 WP_000968919.1.72652 WP_000968919.1.72663 WP_000968919.1.72694 WP_000968919.1.72695 WP_000968919.1.72698 WP_000968919.1.72700 WP_000968919.1.72725 WP_000968919.1.72729 WP_000968919.1.72738 WP_000968919.1.72745 WP_000968919.1.72747 WP_000968919.1.72748 WP_000968919.1.72758 WP_000968919.1.72764 WP_000968919.1.72778 WP_000968919.1.72804 WP_000968919.1.72806 WP_000968919.1.7281 WP_000968919.1.72837 WP_000968919.1.72857 WP_000968919.1.72860 WP_000968919.1.72869 WP_000968919.1.72893 WP_000968919.1.7291 WP_000968919.1.72910 WP_000968919.1.72913 WP_000968919.1.72950 WP_000968919.1.72956 WP_000968919.1.72962 WP_000968919.1.72998 WP_000968919.1.73000 WP_000968919.1.73010 WP_000968919.1.73015 WP_000968919.1.73039 WP_000968919.1.73061 WP_000968919.1.7307 WP_000968919.1.73072 WP_000968919.1.73075 WP_000968919.1.73085 WP_000968919.1.73094 WP_000968919.1.73126 WP_000968919.1.73129 WP_000968919.1.73193 WP_000968919.1.73197 WP_000968919.1.73215 WP_000968919.1.73217 WP_000968919.1.73230 WP_000968919.1.73239 WP_000968919.1.73243 WP_000968919.1.73249 WP_000968919.1.73251 WP_000968919.1.73277 WP_000968919.1.73278 WP_000968919.1.73291 WP_000968919.1.73292 WP_000968919.1.73295 WP_000968919.1.73333 WP_000968919.1.73340 WP_000968919.1.73343 WP_000968919.1.73344 WP_000968919.1.73349 WP_000968919.1.73385 WP_000968919.1.73393 WP_000968919.1.73428 WP_000968919.1.7345 WP_000968919.1.73468 WP_000968919.1.73486 WP_000968919.1.73498 WP_000968919.1.73524 WP_000968919.1.73565 WP_000968919.1.73572 WP_000968919.1.73592 WP_000968919.1.73604 WP_000968919.1.73626 WP_000968919.1.73631 WP_000968919.1.73652 WP_000968919.1.73663 WP_000968919.1.73717 WP_000968919.1.73748 WP_000968919.1.7376 WP_000968919.1.73783 WP_000968919.1.73785 WP_000968919.1.73801 WP_000968919.1.73807 WP_000968919.1.73811 WP_000968919.1.73835 WP_000968919.1.73844 WP_000968919.1.73859 WP_000968919.1.73882 WP_000968919.1.73897 WP_000968919.1.7392 WP_000968919.1.73934 WP_000968919.1.73942 WP_000968919.1.73968 WP_000968919.1.73980 WP_000968919.1.73992 WP_000968919.1.73995 WP_000968919.1.73996 WP_000968919.1.74032 WP_000968919.1.74041 WP_000968919.1.74051 WP_000968919.1.74053 WP_000968919.1.7411 WP_000968919.1.74123 WP_000968919.1.74184 WP_000968919.1.74185 WP_000968919.1.74213 WP_000968919.1.74223 WP_000968919.1.7424 WP_000968919.1.74243 WP_000968919.1.7425 WP_000968919.1.74251 WP_000968919.1.7429 WP_000968919.1.74294 WP_000968919.1.74309 WP_000968919.1.74358 WP_000968919.1.74365 WP_000968919.1.74367 WP_000968919.1.74423 WP_000968919.1.74444 WP_000968919.1.74445 WP_000968919.1.7446 WP_000968919.1.74465 WP_000968919.1.74478 WP_000968919.1.74509 WP_000968919.1.74513 WP_000968919.1.74520 WP_000968919.1.74521 WP_000968919.1.74528 WP_000968919.1.74536 WP_000968919.1.74549 WP_000968919.1.74557 WP_000968919.1.74574 WP_000968919.1.7461 WP_000968919.1.74611 WP_000968919.1.74624 WP_000968919.1.74625 WP_000968919.1.74652 WP_000968919.1.74670 WP_000968919.1.74682 WP_000968919.1.74687 WP_000968919.1.74688 WP_000968919.1.74691 WP_000968919.1.74705 WP_000968919.1.7471 WP_000968919.1.74713 WP_000968919.1.74716 WP_000968919.1.74720 WP_000968919.1.7475 WP_000968919.1.74765 WP_000968919.1.7478 WP_000968919.1.7479 WP_000968919.1.74793 WP_000968919.1.74811 WP_000968919.1.74828 WP_000968919.1.74844 WP_000968919.1.74854 WP_000968919.1.74867 WP_000968919.1.74873 WP_000968919.1.74879 WP_000968919.1.74880 WP_000968919.1.74885 WP_000968919.1.74889 WP_000968919.1.74895 WP_000968919.1.74904 WP_000968919.1.74914 WP_000968919.1.74915 WP_000968919.1.74962 WP_000968919.1.74975 WP_000968919.1.74993 WP_000968919.1.74998 WP_000968919.1.75003 WP_000968919.1.75029 WP_000968919.1.75030 WP_000968919.1.75050 WP_000968919.1.75100 WP_000968919.1.75112 WP_000968919.1.75118 WP_000968919.1.75124 WP_000968919.1.75136 WP_000968919.1.75138 WP_000968919.1.75139 WP_000968919.1.75143 WP_000968919.1.75145 WP_000968919.1.75149 WP_000968919.1.75155 WP_000968919.1.7516 WP_000968919.1.75164 WP_000968919.1.75219 WP_000968919.1.75221 WP_000968919.1.75228 WP_000968919.1.75243 WP_000968919.1.75247 WP_000968919.1.75248 WP_000968919.1.75254 WP_000968919.1.75270 WP_000968919.1.75272 WP_000968919.1.7536 WP_000968919.1.75360 WP_000968919.1.75367 WP_000968919.1.75382 WP_000968919.1.7539 WP_000968919.1.75419 WP_000968919.1.75428 WP_000968919.1.75435 WP_000968919.1.75465 WP_000968919.1.75491 WP_000968919.1.75505 WP_000968919.1.75507 WP_000968919.1.75515 WP_000968919.1.75529 WP_000968919.1.75536 WP_000968919.1.75537 WP_000968919.1.75557 WP_000968919.1.75568 WP_000968919.1.75577 WP_000968919.1.75594 WP_000968919.1.75602 WP_000968919.1.75612 WP_000968919.1.75629 WP_000968919.1.75644 WP_000968919.1.75653 WP_000968919.1.75672 WP_000968919.1.75676 WP_000968919.1.75679 WP_000968919.1.75694 WP_000968919.1.75696 WP_000968919.1.75698 WP_000968919.1.75699 WP_000968919.1.75735 WP_000968919.1.75767 WP_000968919.1.75803 WP_000968919.1.75808 WP_000968919.1.7583 WP_000968919.1.75853 WP_000968919.1.75892 WP_000968919.1.75922 WP_000968919.1.7597 WP_000968919.1.75973 WP_000968919.1.75983 WP_000968919.1.75989 WP_000968919.1.75995 WP_000968919.1.75999 WP_000968919.1.76005 WP_000968919.1.76009 WP_000968919.1.76019 WP_000968919.1.7603 WP_000968919.1.76030 WP_000968919.1.76036 WP_000968919.1.76039 WP_000968919.1.76054 WP_000968919.1.7608 WP_000968919.1.76087 WP_000968919.1.76089 WP_000968919.1.76103 WP_000968919.1.76118 WP_000968919.1.76119 WP_000968919.1.76129 WP_000968919.1.7613 WP_000968919.1.76152 WP_000968919.1.7617 WP_000968919.1.76184 WP_000968919.1.76189 WP_000968919.1.76196 WP_000968919.1.76211 WP_000968919.1.76237 WP_000968919.1.76268 WP_000968919.1.76269 WP_000968919.1.76312 WP_000968919.1.76325 WP_000968919.1.76361 WP_000968919.1.7637 WP_000968919.1.76384 WP_000968919.1.76390 WP_000968919.1.76407 WP_000968919.1.76446 WP_000968919.1.76447 WP_000968919.1.76448 WP_000968919.1.76452 WP_000968919.1.76460 WP_000968919.1.76462 WP_000968919.1.76466 WP_000968919.1.76469 WP_000968919.1.76477 WP_000968919.1.76504 WP_000968919.1.76544 WP_000968919.1.76547 WP_000968919.1.76562 WP_000968919.1.76595 WP_000968919.1.76596 WP_000968919.1.7661 WP_000968919.1.76612 WP_000968919.1.76619 WP_000968919.1.76643 WP_000968919.1.76660 WP_000968919.1.76697 WP_000968919.1.76701 WP_000968919.1.76705 WP_000968919.1.76707 WP_000968919.1.76712 WP_000968919.1.76759 WP_000968919.1.76815 WP_000968919.1.76827 WP_000968919.1.76840 WP_000968919.1.76863 WP_000968919.1.76884 WP_000968919.1.7689 WP_000968919.1.76909 WP_000968919.1.76918 WP_000968919.1.76933 WP_000968919.1.76948 WP_000968919.1.76957 WP_000968919.1.76961 WP_000968919.1.76965 WP_000968919.1.76966 WP_000968919.1.7699 WP_000968919.1.76994 WP_000968919.1.77015 WP_000968919.1.77042 WP_000968919.1.77057 WP_000968919.1.77070 WP_000968919.1.77099 WP_000968919.1.771 WP_000968919.1.77120 WP_000968919.1.77128 WP_000968919.1.77134 WP_000968919.1.77147 WP_000968919.1.77163 WP_000968919.1.77173 WP_000968919.1.77198 WP_000968919.1.77200 WP_000968919.1.77204 WP_000968919.1.77214 WP_000968919.1.77224 WP_000968919.1.77239 WP_000968919.1.77255 WP_000968919.1.77275 WP_000968919.1.77284 WP_000968919.1.77288 WP_000968919.1.7729 WP_000968919.1.77290 WP_000968919.1.77291 WP_000968919.1.7731 WP_000968919.1.77326 WP_000968919.1.77341 WP_000968919.1.77358 WP_000968919.1.77391 WP_000968919.1.77392 WP_000968919.1.77408 WP_000968919.1.77419 WP_000968919.1.77432 WP_000968919.1.77437 WP_000968919.1.77448 WP_000968919.1.77452 WP_000968919.1.77455 WP_000968919.1.77470 WP_000968919.1.77471 WP_000968919.1.77477 WP_000968919.1.77481 WP_000968919.1.77487 WP_000968919.1.77495 WP_000968919.1.775 WP_000968919.1.7750 WP_000968919.1.77542 WP_000968919.1.77551 WP_000968919.1.7756 WP_000968919.1.77581 WP_000968919.1.77595 WP_000968919.1.77600 WP_000968919.1.77608 WP_000968919.1.77626 WP_000968919.1.77636 WP_000968919.1.77643 WP_000968919.1.77644 WP_000968919.1.77648 WP_000968919.1.77657 WP_000968919.1.77707 WP_000968919.1.77725 WP_000968919.1.77741 WP_000968919.1.7775 WP_000968919.1.77760 WP_000968919.1.77767 WP_000968919.1.77768 WP_000968919.1.7780 WP_000968919.1.77813 WP_000968919.1.77816 WP_000968919.1.77826 WP_000968919.1.77833 WP_000968919.1.77876 WP_000968919.1.77929 WP_000968919.1.77949 WP_000968919.1.7795 WP_000968919.1.77950 WP_000968919.1.77961 WP_000968919.1.77979 WP_000968919.1.7799 WP_000968919.1.77999 WP_000968919.1.78000 WP_000968919.1.78007 WP_000968919.1.78010 WP_000968919.1.7804 WP_000968919.1.78041 WP_000968919.1.78059 WP_000968919.1.7806 WP_000968919.1.78063 WP_000968919.1.7808 WP_000968919.1.78089 WP_000968919.1.78097 WP_000968919.1.78099 WP_000968919.1.78101 WP_000968919.1.78102 WP_000968919.1.78183 WP_000968919.1.78196 WP_000968919.1.78202 WP_000968919.1.78232 WP_000968919.1.78233 WP_000968919.1.78297 WP_000968919.1.78305 WP_000968919.1.78321 WP_000968919.1.78337 WP_000968919.1.78340 WP_000968919.1.78368 WP_000968919.1.78376 WP_000968919.1.78377 WP_000968919.1.78390 WP_000968919.1.784 WP_000968919.1.78413 WP_000968919.1.78463 WP_000968919.1.7847 WP_000968919.1.78481 WP_000968919.1.78491 WP_000968919.1.7851 WP_000968919.1.78512 WP_000968919.1.78515 WP_000968919.1.78523 WP_000968919.1.78527 WP_000968919.1.7855 WP_000968919.1.78553 WP_000968919.1.78572 WP_000968919.1.78575 WP_000968919.1.78581 WP_000968919.1.78583 WP_000968919.1.78586 WP_000968919.1.78593 WP_000968919.1.78610 WP_000968919.1.78611 WP_000968919.1.78612 WP_000968919.1.78615 WP_000968919.1.78622 WP_000968919.1.78645 WP_000968919.1.78677 WP_000968919.1.78683 WP_000968919.1.78687 WP_000968919.1.78689 WP_000968919.1.78696 WP_000968919.1.78714 WP_000968919.1.78746 WP_000968919.1.78750 WP_000968919.1.78773 WP_000968919.1.78775 WP_000968919.1.78791 WP_000968919.1.78814 WP_000968919.1.78843 WP_000968919.1.78845 WP_000968919.1.78854 WP_000968919.1.78888 WP_000968919.1.78891 WP_000968919.1.78893 WP_000968919.1.78895 WP_000968919.1.78919 WP_000968919.1.78953 WP_000968919.1.78955 WP_000968919.1.78956 WP_000968919.1.7896 WP_000968919.1.78966 WP_000968919.1.7898 WP_000968919.1.78996 WP_000968919.1.79001 WP_000968919.1.79002 WP_000968919.1.79004 WP_000968919.1.7901 WP_000968919.1.79065 WP_000968919.1.79075 WP_000968919.1.79086 WP_000968919.1.79088 WP_000968919.1.79090 WP_000968919.1.79092 WP_000968919.1.79100 WP_000968919.1.79137 WP_000968919.1.79159 WP_000968919.1.79172 WP_000968919.1.79226 WP_000968919.1.79243 WP_000968919.1.79246 WP_000968919.1.79248 WP_000968919.1.79249 WP_000968919.1.79276 WP_000968919.1.79306 WP_000968919.1.79308 WP_000968919.1.79312 WP_000968919.1.79346 WP_000968919.1.79348 WP_000968919.1.79365 WP_000968919.1.79368 WP_000968919.1.7937 WP_000968919.1.79389 WP_000968919.1.79391 WP_000968919.1.7940 WP_000968919.1.79409 WP_000968919.1.79414 WP_000968919.1.79416 WP_000968919.1.79478 WP_000968919.1.79505 WP_000968919.1.79519 WP_000968919.1.7952 WP_000968919.1.79525 WP_000968919.1.79526 WP_000968919.1.79528 WP_000968919.1.79558 WP_000968919.1.79563 WP_000968919.1.79576 WP_000968919.1.79619 WP_000968919.1.79640 WP_000968919.1.7967 WP_000968919.1.79685 WP_000968919.1.79707 WP_000968919.1.79713 WP_000968919.1.79715 WP_000968919.1.79749 WP_000968919.1.79764 WP_000968919.1.79800 WP_000968919.1.79824 WP_000968919.1.79840 WP_000968919.1.7985 WP_000968919.1.79866 WP_000968919.1.79869 WP_000968919.1.7987 WP_000968919.1.79871 WP_000968919.1.79905 WP_000968919.1.7993 WP_000968919.1.79930 WP_000968919.1.79931 WP_000968919.1.79932 WP_000968919.1.79933 WP_000968919.1.79936 WP_000968919.1.79944 WP_000968919.1.79952 WP_000968919.1.79955 WP_000968919.1.79965 WP_000968919.1.79973 WP_000968919.1.79984 WP_000968919.1.79995 WP_000968919.1.80 WP_000968919.1.80011 WP_000968919.1.80016 WP_000968919.1.80026 WP_000968919.1.8004 WP_000968919.1.80043 WP_000968919.1.80061 WP_000968919.1.80063 WP_000968919.1.8007 WP_000968919.1.80071 WP_000968919.1.80096 WP_000968919.1.80136 WP_000968919.1.80141 WP_000968919.1.80168 WP_000968919.1.80176 WP_000968919.1.80183 WP_000968919.1.80192 WP_000968919.1.80255 WP_000968919.1.80292 WP_000968919.1.80309 WP_000968919.1.80310 WP_000968919.1.80320 WP_000968919.1.80330 WP_000968919.1.80343 WP_000968919.1.80388 WP_000968919.1.80392 WP_000968919.1.80402 WP_000968919.1.80426 WP_000968919.1.80428 WP_000968919.1.80440 WP_000968919.1.80444 WP_000968919.1.80456 WP_000968919.1.80463 WP_000968919.1.80484 WP_000968919.1.80517 WP_000968919.1.80519 WP_000968919.1.80524 WP_000968919.1.80545 WP_000968919.1.80559 WP_000968919.1.8057 WP_000968919.1.80578 WP_000968919.1.80594 WP_000968919.1.80606 WP_000968919.1.80612 WP_000968919.1.80626 WP_000968919.1.80660 WP_000968919.1.80662 WP_000968919.1.80666 WP_000968919.1.80676 WP_000968919.1.8068 WP_000968919.1.80709 WP_000968919.1.80731 WP_000968919.1.80736 WP_000968919.1.80737 WP_000968919.1.8074 WP_000968919.1.80754 WP_000968919.1.8076 WP_000968919.1.80768 WP_000968919.1.80789 WP_000968919.1.80804 WP_000968919.1.80805 WP_000968919.1.80843 WP_000968919.1.80882 WP_000968919.1.80884 WP_000968919.1.80894 WP_000968919.1.8090 WP_000968919.1.8091 WP_000968919.1.80946 WP_000968919.1.80948 WP_000968919.1.80954 WP_000968919.1.80966 WP_000968919.1.80983 WP_000968919.1.80985 WP_000968919.1.810 WP_000968919.1.81032 WP_000968919.1.81034 WP_000968919.1.81036 WP_000968919.1.81054 WP_000968919.1.81056 WP_000968919.1.81070 WP_000968919.1.81071 WP_000968919.1.81098 WP_000968919.1.81104 WP_000968919.1.81120 WP_000968919.1.81141 WP_000968919.1.81156 WP_000968919.1.81160 WP_000968919.1.8118 WP_000968919.1.81180 WP_000968919.1.81182 WP_000968919.1.8121 WP_000968919.1.81219 WP_000968919.1.81266 WP_000968919.1.81267 WP_000968919.1.81273 WP_000968919.1.81281 WP_000968919.1.81283 WP_000968919.1.81286 WP_000968919.1.8129 WP_000968919.1.81298 WP_000968919.1.81313 WP_000968919.1.81316 WP_000968919.1.81323 WP_000968919.1.81376 WP_000968919.1.81391 WP_000968919.1.814 WP_000968919.1.81420 WP_000968919.1.81442 WP_000968919.1.81469 WP_000968919.1.81484 WP_000968919.1.81514 WP_000968919.1.81517 WP_000968919.1.8156 WP_000968919.1.81576 WP_000968919.1.81577 WP_000968919.1.81582 WP_000968919.1.81588 WP_000968919.1.81589 WP_000968919.1.81596 WP_000968919.1.81602 WP_000968919.1.81624 WP_000968919.1.81625 WP_000968919.1.81688 WP_000968919.1.81692 WP_000968919.1.81715 WP_000968919.1.81723 WP_000968919.1.81754 WP_000968919.1.81806 WP_000968919.1.81819 WP_000968919.1.81821 WP_000968919.1.8183 WP_000968919.1.81832 WP_000968919.1.81869 WP_000968919.1.81873 WP_000968919.1.81876 WP_000968919.1.81881 WP_000968919.1.81914 WP_000968919.1.81934 WP_000968919.1.81935 WP_000968919.1.81939 WP_000968919.1.81952 WP_000968919.1.81956 WP_000968919.1.81972 WP_000968919.1.81975 WP_000968919.1.82 WP_000968919.1.82008 WP_000968919.1.82010 WP_000968919.1.82032 WP_000968919.1.82057 WP_000968919.1.82059 WP_000968919.1.82061 WP_000968919.1.82062 WP_000968919.1.82095 WP_000968919.1.82104 WP_000968919.1.82106 WP_000968919.1.82116 WP_000968919.1.82123 WP_000968919.1.82137 WP_000968919.1.82221 WP_000968919.1.82239 WP_000968919.1.82240 WP_000968919.1.82246 WP_000968919.1.82275 WP_000968919.1.82280 WP_000968919.1.82296 WP_000968919.1.82316 WP_000968919.1.82320 WP_000968919.1.82326 WP_000968919.1.8235 WP_000968919.1.82378 WP_000968919.1.82438 WP_000968919.1.82439 WP_000968919.1.82485 WP_000968919.1.82499 WP_000968919.1.82507 WP_000968919.1.82514 WP_000968919.1.82527 WP_000968919.1.82539 WP_000968919.1.8255 WP_000968919.1.82572 WP_000968919.1.82594 WP_000968919.1.82614 WP_000968919.1.82626 WP_000968919.1.82629 WP_000968919.1.82647 WP_000968919.1.82661 WP_000968919.1.8268 WP_000968919.1.82682 WP_000968919.1.82691 WP_000968919.1.82705 WP_000968919.1.82711 WP_000968919.1.82715 WP_000968919.1.82747 WP_000968919.1.82754 WP_000968919.1.82776 WP_000968919.1.82780 WP_000968919.1.82784 WP_000968919.1.82797 WP_000968919.1.82816 WP_000968919.1.82820 WP_000968919.1.82831 WP_000968919.1.82833 WP_000968919.1.82853 WP_000968919.1.82901 WP_000968919.1.82902 WP_000968919.1.82923 WP_000968919.1.8295 WP_000968919.1.82991 WP_000968919.1.83020 WP_000968919.1.83033 WP_000968919.1.83035 WP_000968919.1.83036 WP_000968919.1.83051 WP_000968919.1.83059 WP_000968919.1.8308 WP_000968919.1.83093 WP_000968919.1.83097 WP_000968919.1.83099 WP_000968919.1.831 WP_000968919.1.83118 WP_000968919.1.83125 WP_000968919.1.83127 WP_000968919.1.83140 WP_000968919.1.83144 WP_000968919.1.83160 WP_000968919.1.83177 WP_000968919.1.83205 WP_000968919.1.83224 WP_000968919.1.83238 WP_000968919.1.83253 WP_000968919.1.83256 WP_000968919.1.83286 WP_000968919.1.83321 WP_000968919.1.83340 WP_000968919.1.83347 WP_000968919.1.83375 WP_000968919.1.83415 WP_000968919.1.8345 WP_000968919.1.83466 WP_000968919.1.83481 WP_000968919.1.83537 WP_000968919.1.83544 WP_000968919.1.83564 WP_000968919.1.83644 WP_000968919.1.83684 WP_000968919.1.83706 WP_000968919.1.83712 WP_000968919.1.83735 WP_000968919.1.83762 WP_000968919.1.83807 WP_000968919.1.83820 WP_000968919.1.8384 WP_000968919.1.8386 WP_000968919.1.83879 WP_000968919.1.83911 WP_000968919.1.83941 WP_000968919.1.83947 WP_000968919.1.84004 WP_000968919.1.84014 WP_000968919.1.84021 WP_000968919.1.8405 WP_000968919.1.84059 WP_000968919.1.84074 WP_000968919.1.8408 WP_000968919.1.8411 WP_000968919.1.84140 WP_000968919.1.84164 WP_000968919.1.84172 WP_000968919.1.84185 WP_000968919.1.84210 WP_000968919.1.84215 WP_000968919.1.84219 WP_000968919.1.84221 WP_000968919.1.84264 WP_000968919.1.84298 WP_000968919.1.84312 WP_000968919.1.84313 WP_000968919.1.84316 WP_000968919.1.84331 WP_000968919.1.84339 WP_000968919.1.84348 WP_000968919.1.84405 WP_000968919.1.84410 WP_000968919.1.84436 WP_000968919.1.8444 WP_000968919.1.84462 WP_000968919.1.84464 WP_000968919.1.84467 WP_000968919.1.8447 WP_000968919.1.84473 WP_000968919.1.84476 WP_000968919.1.84482 WP_000968919.1.84484 WP_000968919.1.84486 WP_000968919.1.84511 WP_000968919.1.84518 WP_000968919.1.84531 WP_000968919.1.84534 WP_000968919.1.84584 WP_000968919.1.84635 WP_000968919.1.84639 WP_000968919.1.84656 WP_000968919.1.84657 WP_000968919.1.84668 WP_000968919.1.84675 WP_000968919.1.84697 WP_000968919.1.8470 WP_000968919.1.84738 WP_000968919.1.84740 WP_000968919.1.84768 WP_000968919.1.8477 WP_000968919.1.84797 WP_000968919.1.84841 WP_000968919.1.84850 WP_000968919.1.84875 WP_000968919.1.84877 WP_000968919.1.84878 WP_000968919.1.84881 WP_000968919.1.84893 WP_000968919.1.84916 WP_000968919.1.84948 WP_000968919.1.84966 WP_000968919.1.84977 WP_000968919.1.84986 WP_000968919.1.84989 WP_000968919.1.84990 WP_000968919.1.84994 WP_000968919.1.85002 WP_000968919.1.85008 WP_000968919.1.85011 WP_000968919.1.85025 WP_000968919.1.85048 WP_000968919.1.85085 WP_000968919.1.85098 WP_000968919.1.85105 WP_000968919.1.85106 WP_000968919.1.85112 WP_000968919.1.85125 WP_000968919.1.85129 WP_000968919.1.85138 WP_000968919.1.85141 WP_000968919.1.85156 WP_000968919.1.8517 WP_000968919.1.85216 WP_000968919.1.85247 WP_000968919.1.85252 WP_000968919.1.85253 WP_000968919.1.85255 WP_000968919.1.85260 WP_000968919.1.8530 WP_000968919.1.85305 WP_000968919.1.85310 WP_000968919.1.85315 WP_000968919.1.85329 WP_000968919.1.85335 WP_000968919.1.85336 WP_000968919.1.85342 WP_000968919.1.85369 WP_000968919.1.85384 WP_000968919.1.85385 WP_000968919.1.85416 WP_000968919.1.85500 WP_000968919.1.85504 WP_000968919.1.85525 WP_000968919.1.85546 WP_000968919.1.85554 WP_000968919.1.85556 WP_000968919.1.85558 WP_000968919.1.85563 WP_000968919.1.85578 WP_000968919.1.85593 WP_000968919.1.85601 WP_000968919.1.85621 WP_000968919.1.85623 WP_000968919.1.8564 WP_000968919.1.85685 WP_000968919.1.85722 WP_000968919.1.85752 WP_000968919.1.85767 WP_000968919.1.85772 WP_000968919.1.85773 WP_000968919.1.85793 WP_000968919.1.85800 WP_000968919.1.85806 WP_000968919.1.85857 WP_000968919.1.85895 WP_000968919.1.8592 WP_000968919.1.85939 WP_000968919.1.85948 WP_000968919.1.85969 WP_000968919.1.86 WP_000968919.1.86001 WP_000968919.1.86016 WP_000968919.1.8603 WP_000968919.1.86035 WP_000968919.1.86063 WP_000968919.1.8607 WP_000968919.1.86104 WP_000968919.1.86105 WP_000968919.1.86115 WP_000968919.1.86145 WP_000968919.1.86161 WP_000968919.1.86166 WP_000968919.1.86171 WP_000968919.1.86176 WP_000968919.1.86179 WP_000968919.1.86181 WP_000968919.1.86189 WP_000968919.1.86196 WP_000968919.1.8621 WP_000968919.1.86225 WP_000968919.1.86227 WP_000968919.1.86228 WP_000968919.1.86234 WP_000968919.1.86255 WP_000968919.1.86261 WP_000968919.1.86263 WP_000968919.1.86273 WP_000968919.1.86276 WP_000968919.1.86280 WP_000968919.1.86307 WP_000968919.1.86340 WP_000968919.1.8635 WP_000968919.1.86353 WP_000968919.1.86364 WP_000968919.1.86376 WP_000968919.1.86393 WP_000968919.1.86411 WP_000968919.1.86412 WP_000968919.1.86437 WP_000968919.1.86451 WP_000968919.1.86452 WP_000968919.1.86454 WP_000968919.1.86461 WP_000968919.1.86475 WP_000968919.1.86483 WP_000968919.1.86492 WP_000968919.1.86518 WP_000968919.1.8652 WP_000968919.1.8656 WP_000968919.1.86560 WP_000968919.1.86574 WP_000968919.1.86583 WP_000968919.1.86598 WP_000968919.1.86613 WP_000968919.1.86627 WP_000968919.1.86667 WP_000968919.1.86673 WP_000968919.1.86674 WP_000968919.1.86681 WP_000968919.1.86691 WP_000968919.1.86707 WP_000968919.1.86727 WP_000968919.1.86731 WP_000968919.1.86753 WP_000968919.1.86760 WP_000968919.1.86768 WP_000968919.1.86787 WP_000968919.1.8679 WP_000968919.1.86833 WP_000968919.1.86846 WP_000968919.1.86848 WP_000968919.1.8687 WP_000968919.1.86935 WP_000968919.1.86956 WP_000968919.1.86959 WP_000968919.1.86975 WP_000968919.1.86994 WP_000968919.1.86997 WP_000968919.1.87043 WP_000968919.1.87059 WP_000968919.1.87067 WP_000968919.1.87074 WP_000968919.1.87075 WP_000968919.1.87076 WP_000968919.1.87102 WP_000968919.1.87109 WP_000968919.1.8711 WP_000968919.1.87147 WP_000968919.1.87177 WP_000968919.1.87199 WP_000968919.1.87205 WP_000968919.1.87247 WP_000968919.1.87254 WP_000968919.1.87310 WP_000968919.1.87339 WP_000968919.1.87358 WP_000968919.1.87371 WP_000968919.1.87382 WP_000968919.1.87389 WP_000968919.1.87400 WP_000968919.1.87410 WP_000968919.1.87443 WP_000968919.1.87465 WP_000968919.1.87491 WP_000968919.1.87557 WP_000968919.1.87563 WP_000968919.1.87574 WP_000968919.1.87581 WP_000968919.1.87607 WP_000968919.1.87608 WP_000968919.1.87610 WP_000968919.1.87616 WP_000968919.1.87633 WP_000968919.1.87635 WP_000968919.1.87639 WP_000968919.1.87655 WP_000968919.1.87675 WP_000968919.1.87694 WP_000968919.1.87696 WP_000968919.1.8771 WP_000968919.1.87721 WP_000968919.1.87726 WP_000968919.1.87728 WP_000968919.1.87738 WP_000968919.1.87766 WP_000968919.1.8778 WP_000968919.1.87786 WP_000968919.1.87822 WP_000968919.1.87834 WP_000968919.1.87883 WP_000968919.1.87914 WP_000968919.1.87919 WP_000968919.1.87973 WP_000968919.1.87976 WP_000968919.1.87984 WP_000968919.1.87989 WP_000968919.1.87990 WP_000968919.1.880 WP_000968919.1.88017 WP_000968919.1.88020 WP_000968919.1.88066 WP_000968919.1.8807 WP_000968919.1.88082 WP_000968919.1.88088 WP_000968919.1.88110 WP_000968919.1.88119 WP_000968919.1.88147 WP_000968919.1.88155 WP_000968919.1.88189 WP_000968919.1.88197 WP_000968919.1.8822 WP_000968919.1.88234 WP_000968919.1.88238 WP_000968919.1.88252 WP_000968919.1.88263 WP_000968919.1.88285 WP_000968919.1.88301 WP_000968919.1.88304 WP_000968919.1.88336 WP_000968919.1.88352 WP_000968919.1.88379 WP_000968919.1.88384 WP_000968919.1.88413 WP_000968919.1.88427 WP_000968919.1.8843 WP_000968919.1.88434 WP_000968919.1.88438 WP_000968919.1.88462 WP_000968919.1.88467 WP_000968919.1.8848 WP_000968919.1.88499 WP_000968919.1.88505 WP_000968919.1.88524 WP_000968919.1.88527 WP_000968919.1.88528 WP_000968919.1.88535 WP_000968919.1.88539 WP_000968919.1.8854 WP_000968919.1.8855 WP_000968919.1.88577 WP_000968919.1.88598 WP_000968919.1.88603 WP_000968919.1.88607 WP_000968919.1.88646 WP_000968919.1.88667 WP_000968919.1.88678 WP_000968919.1.88685 WP_000968919.1.88686 WP_000968919.1.88709 WP_000968919.1.88710 WP_000968919.1.88711 WP_000968919.1.88720 WP_000968919.1.88729 WP_000968919.1.8873 WP_000968919.1.88732 WP_000968919.1.88735 WP_000968919.1.88752 WP_000968919.1.88757 WP_000968919.1.88759 WP_000968919.1.88767 WP_000968919.1.8879 WP_000968919.1.88793 WP_000968919.1.88803 WP_000968919.1.88826 WP_000968919.1.88864 WP_000968919.1.88880 WP_000968919.1.88883 WP_000968919.1.88891 WP_000968919.1.88950 WP_000968919.1.88953 WP_000968919.1.88961 WP_000968919.1.88997 WP_000968919.1.89018 WP_000968919.1.89043 WP_000968919.1.89050 WP_000968919.1.8906 WP_000968919.1.89067 WP_000968919.1.89069 WP_000968919.1.89090 WP_000968919.1.89097 WP_000968919.1.89099 WP_000968919.1.89111 WP_000968919.1.89150 WP_000968919.1.89163 WP_000968919.1.89183 WP_000968919.1.89197 WP_000968919.1.89200 WP_000968919.1.89203 WP_000968919.1.89217 WP_000968919.1.89255 WP_000968919.1.8928 WP_000968919.1.89285 WP_000968919.1.89305 WP_000968919.1.89312 WP_000968919.1.89322 WP_000968919.1.89334 WP_000968919.1.89335 WP_000968919.1.89379 WP_000968919.1.8938 WP_000968919.1.89396 WP_000968919.1.894 WP_000968919.1.89400 WP_000968919.1.89405 WP_000968919.1.89416 WP_000968919.1.89432 WP_000968919.1.8945 WP_000968919.1.89455 WP_000968919.1.89458 WP_000968919.1.89468 WP_000968919.1.89469 WP_000968919.1.89471 WP_000968919.1.89474 WP_000968919.1.89479 WP_000968919.1.89496 WP_000968919.1.89510 WP_000968919.1.89551 WP_000968919.1.89569 WP_000968919.1.89601 WP_000968919.1.89605 WP_000968919.1.89627 WP_000968919.1.89630 WP_000968919.1.89631 WP_000968919.1.89646 WP_000968919.1.89656 WP_000968919.1.89674 WP_000968919.1.89679 WP_000968919.1.89700 WP_000968919.1.89768 WP_000968919.1.89781 WP_000968919.1.89788 WP_000968919.1.89839 WP_000968919.1.89841 WP_000968919.1.8985 WP_000968919.1.89852 WP_000968919.1.89859 WP_000968919.1.89879 WP_000968919.1.89895 WP_000968919.1.89899 WP_000968919.1.89915 WP_000968919.1.89917 WP_000968919.1.89918 WP_000968919.1.89920 WP_000968919.1.89923 WP_000968919.1.89925 WP_000968919.1.89927 WP_000968919.1.89959 WP_000968919.1.89977 WP_000968919.1.89988 WP_000968919.1.89998 WP_000968919.1.90017 WP_000968919.1.90050 WP_000968919.1.90065 WP_000968919.1.90078 WP_000968919.1.9009 WP_000968919.1.9010 WP_000968919.1.90115 WP_000968919.1.90128 WP_000968919.1.90139 WP_000968919.1.90156 WP_000968919.1.90168 WP_000968919.1.90171 WP_000968919.1.90182 WP_000968919.1.902 WP_000968919.1.90205 WP_000968919.1.90219 WP_000968919.1.90249 WP_000968919.1.90256 WP_000968919.1.90257 WP_000968919.1.90266 WP_000968919.1.90270 WP_000968919.1.90314 WP_000968919.1.90332 WP_000968919.1.90342 WP_000968919.1.90346 WP_000968919.1.90349 WP_000968919.1.90357 WP_000968919.1.90358 WP_000968919.1.9036 WP_000968919.1.9037 WP_000968919.1.90389 WP_000968919.1.90405 WP_000968919.1.90435 WP_000968919.1.90436 WP_000968919.1.90441 WP_000968919.1.90449 WP_000968919.1.90467 WP_000968919.1.90511 WP_000968919.1.90520 WP_000968919.1.90525 WP_000968919.1.90536 WP_000968919.1.90547 WP_000968919.1.9059 WP_000968919.1.90591 WP_000968919.1.9061 WP_000968919.1.90626 WP_000968919.1.90690 WP_000968919.1.90703 WP_000968919.1.90706 WP_000968919.1.90758 WP_000968919.1.90775 WP_000968919.1.90799 WP_000968919.1.9081 WP_000968919.1.90828 WP_000968919.1.90834 WP_000968919.1.90837 WP_000968919.1.9084 WP_000968919.1.90842 WP_000968919.1.90844 WP_000968919.1.90848 WP_000968919.1.90864 WP_000968919.1.9087 WP_000968919.1.90873 WP_000968919.1.909 WP_000968919.1.90905 WP_000968919.1.90951 WP_000968919.1.90960 WP_000968919.1.90967 WP_000968919.1.90979 WP_000968919.1.9098 WP_000968919.1.90988 WP_000968919.1.90996 WP_000968919.1.90997 WP_000968919.1.91 WP_000968919.1.91018 WP_000968919.1.9104 WP_000968919.1.91072 WP_000968919.1.91088 WP_000968919.1.91094 WP_000968919.1.91113 WP_000968919.1.91117 WP_000968919.1.91121 WP_000968919.1.91138 WP_000968919.1.91143 WP_000968919.1.91153 WP_000968919.1.91170 WP_000968919.1.9118 WP_000968919.1.91182 WP_000968919.1.91268 WP_000968919.1.91277 WP_000968919.1.91288 WP_000968919.1.91340 WP_000968919.1.91341 WP_000968919.1.91354 WP_000968919.1.91356 WP_000968919.1.91384 WP_000968919.1.91397 WP_000968919.1.91414 WP_000968919.1.91445 WP_000968919.1.91462 WP_000968919.1.91515 WP_000968919.1.91516 WP_000968919.1.91526 WP_000968919.1.91548 WP_000968919.1.91551 WP_000968919.1.91565 WP_000968919.1.91566 WP_000968919.1.91594 WP_000968919.1.9160 WP_000968919.1.91626 WP_000968919.1.91630 WP_000968919.1.91640 WP_000968919.1.91643 WP_000968919.1.91644 WP_000968919.1.91651 WP_000968919.1.91672 WP_000968919.1.9168 WP_000968919.1.91685 WP_000968919.1.9169 WP_000968919.1.91701 WP_000968919.1.9171 WP_000968919.1.91739 WP_000968919.1.91756 WP_000968919.1.91777 WP_000968919.1.91779 WP_000968919.1.91782 WP_000968919.1.91787 WP_000968919.1.91793 WP_000968919.1.91801 WP_000968919.1.91843 WP_000968919.1.91850 WP_000968919.1.91863 WP_000968919.1.91871 WP_000968919.1.91879 WP_000968919.1.91893 WP_000968919.1.91951 WP_000968919.1.91954 WP_000968919.1.91959 WP_000968919.1.91971 WP_000968919.1.9199 WP_000968919.1.91994 WP_000968919.1.92005 WP_000968919.1.92014 WP_000968919.1.92025 WP_000968919.1.92029 WP_000968919.1.92031 WP_000968919.1.92048 WP_000968919.1.92058 WP_000968919.1.9209 WP_000968919.1.92096 WP_000968919.1.921 WP_000968919.1.92114 WP_000968919.1.92123 WP_000968919.1.9215 WP_000968919.1.92161 WP_000968919.1.92163 WP_000968919.1.92180 WP_000968919.1.92195 WP_000968919.1.92215 WP_000968919.1.92224 WP_000968919.1.92276 WP_000968919.1.92295 WP_000968919.1.92304 WP_000968919.1.92305 WP_000968919.1.92311 WP_000968919.1.92323 WP_000968919.1.92361 WP_000968919.1.92384 WP_000968919.1.924 WP_000968919.1.92434 WP_000968919.1.92462 WP_000968919.1.92495 WP_000968919.1.92496 WP_000968919.1.92506 WP_000968919.1.92532 WP_000968919.1.92535 WP_000968919.1.92568 WP_000968919.1.92571 WP_000968919.1.92577 WP_000968919.1.92614 WP_000968919.1.92615 WP_000968919.1.92634 WP_000968919.1.92638 WP_000968919.1.9264 WP_000968919.1.9266 WP_000968919.1.92693 WP_000968919.1.92719 WP_000968919.1.92742 WP_000968919.1.92750 WP_000968919.1.92767 WP_000968919.1.92792 WP_000968919.1.92793 WP_000968919.1.92796 WP_000968919.1.92819 WP_000968919.1.92845 WP_000968919.1.92865 WP_000968919.1.92932 WP_000968919.1.92943 WP_000968919.1.92953 WP_000968919.1.92989 WP_000968919.1.92991 WP_000968919.1.93005 WP_000968919.1.93016 WP_000968919.1.93017 WP_000968919.1.93019 WP_000968919.1.93023 WP_000968919.1.93027 WP_000968919.1.93033 WP_000968919.1.93048 WP_000968919.1.93054 WP_000968919.1.93069 WP_000968919.1.93072 WP_000968919.1.93085 WP_000968919.1.93100 WP_000968919.1.93112 WP_000968919.1.93133 WP_000968919.1.93138 WP_000968919.1.93139 WP_000968919.1.93175 WP_000968919.1.93185 WP_000968919.1.93233 WP_000968919.1.93252 WP_000968919.1.93267 WP_000968919.1.9327 WP_000968919.1.93276 WP_000968919.1.93291 WP_000968919.1.93309 WP_000968919.1.93312 WP_000968919.1.93326 WP_000968919.1.93338 WP_000968919.1.93379 WP_000968919.1.93388 WP_000968919.1.934 WP_000968919.1.93427 WP_000968919.1.93428 WP_000968919.1.93431 WP_000968919.1.93453 WP_000968919.1.93461 WP_000968919.1.93463 WP_000968919.1.93464 WP_000968919.1.93468 WP_000968919.1.93509 WP_000968919.1.93531 WP_000968919.1.93569 WP_000968919.1.93601 WP_000968919.1.93605 WP_000968919.1.93621 WP_000968919.1.93626 WP_000968919.1.93629 WP_000968919.1.93630 WP_000968919.1.93634 WP_000968919.1.93637 WP_000968919.1.93652 WP_000968919.1.93665 WP_000968919.1.93670 WP_000968919.1.93673 WP_000968919.1.93679 WP_000968919.1.93695 WP_000968919.1.93716 WP_000968919.1.93737 WP_000968919.1.93742 WP_000968919.1.93743 WP_000968919.1.93755 WP_000968919.1.93765 WP_000968919.1.93768 WP_000968919.1.938 WP_000968919.1.93800 WP_000968919.1.93821 WP_000968919.1.93870 WP_000968919.1.93873 WP_000968919.1.93877 WP_000968919.1.939 WP_000968919.1.93900 WP_000968919.1.93911 WP_000968919.1.93918 WP_000968919.1.93921 WP_000968919.1.93922 WP_000968919.1.93939 WP_000968919.1.93951 WP_000968919.1.93952 WP_000968919.1.93971 WP_000968919.1.94008 WP_000968919.1.94011 WP_000968919.1.94025 WP_000968919.1.94028 WP_000968919.1.94035 WP_000968919.1.94040 WP_000968919.1.94057 WP_000968919.1.94069 WP_000968919.1.94156 WP_000968919.1.94176 WP_000968919.1.94187 WP_000968919.1.94190 WP_000968919.1.94213 WP_000968919.1.94232 WP_000968919.1.9426 WP_000968919.1.94271 WP_000968919.1.94302 WP_000968919.1.94317 WP_000968919.1.94343 WP_000968919.1.94367 WP_000968919.1.94388 WP_000968919.1.94404 WP_000968919.1.94417 WP_000968919.1.94429 WP_000968919.1.94430 WP_000968919.1.94436 WP_000968919.1.94438 WP_000968919.1.94445 WP_000968919.1.94475 WP_000968919.1.94497 WP_000968919.1.94507 WP_000968919.1.94516 WP_000968919.1.94523 WP_000968919.1.94542 WP_000968919.1.94544 WP_000968919.1.9457 WP_000968919.1.94578 WP_000968919.1.94580 WP_000968919.1.94589 WP_000968919.1.94619 WP_000968919.1.94626 WP_000968919.1.94653 WP_000968919.1.94676 WP_000968919.1.94686 WP_000968919.1.94690 WP_000968919.1.94695 WP_000968919.1.94738 WP_000968919.1.94739 WP_000968919.1.9474 WP_000968919.1.94753 WP_000968919.1.94754 WP_000968919.1.94764 WP_000968919.1.94787 WP_000968919.1.94790 WP_000968919.1.948 WP_000968919.1.94801 WP_000968919.1.94806 WP_000968919.1.94836 WP_000968919.1.94847 WP_000968919.1.94869 WP_000968919.1.94877 WP_000968919.1.94880 WP_000968919.1.94889 WP_000968919.1.9489 WP_000968919.1.94892 WP_000968919.1.94898 WP_000968919.1.949 WP_000968919.1.94903 WP_000968919.1.94927 WP_000968919.1.94934 WP_000968919.1.94935 WP_000968919.1.94938 WP_000968919.1.94949 WP_000968919.1.94955 WP_000968919.1.94963 WP_000968919.1.94991 WP_000968919.1.94993 WP_000968919.1.94997 WP_000968919.1.95005 WP_000968919.1.95011 WP_000968919.1.95022 WP_000968919.1.95028 WP_000968919.1.95035 WP_000968919.1.95036 WP_000968919.1.95037 WP_000968919.1.95062 WP_000968919.1.95084 WP_000968919.1.95105 WP_000968919.1.95129 WP_000968919.1.95161 WP_000968919.1.95198 WP_000968919.1.95233 WP_000968919.1.95243 WP_000968919.1.95254 WP_000968919.1.95275 WP_000968919.1.95329 WP_000968919.1.95332 WP_000968919.1.95364 WP_000968919.1.95366 WP_000968919.1.95368 WP_000968919.1.95378 WP_000968919.1.95381 WP_000968919.1.95390 WP_000968919.1.95395 WP_000968919.1.95398 WP_000968919.1.95400 WP_000968919.1.95403 WP_000968919.1.95424 WP_000968919.1.95428 WP_000968919.1.95431 WP_000968919.1.95449 WP_000968919.1.95490 WP_000968919.1.95521 WP_000968919.1.95563 WP_000968919.1.95595 WP_000968919.1.95596 WP_000968919.1.95604 WP_000968919.1.95611 WP_000968919.1.95628 WP_000968919.1.95634 WP_000968919.1.9566 WP_000968919.1.95666 WP_000968919.1.95680 WP_000968919.1.95712 WP_000968919.1.95756 WP_000968919.1.95759 WP_000968919.1.95771 WP_000968919.1.95783 WP_000968919.1.95784 WP_000968919.1.95800 WP_000968919.1.95801 WP_000968919.1.95821 WP_000968919.1.95824 WP_000968919.1.95827 WP_000968919.1.95834 WP_000968919.1.95835 WP_000968919.1.95849 WP_000968919.1.95861 WP_000968919.1.95865 WP_000968919.1.95869 WP_000968919.1.95916 WP_000968919.1.95919 WP_000968919.1.95929 WP_000968919.1.95931 WP_000968919.1.95932 WP_000968919.1.95951 WP_000968919.1.960 WP_000968919.1.96015 WP_000968919.1.96032 WP_000968919.1.96053 WP_000968919.1.96059 WP_000968919.1.96066 WP_000968919.1.96086 WP_000968919.1.96097 WP_000968919.1.96110 WP_000968919.1.96128 WP_000968919.1.96143 WP_000968919.1.96145 WP_000968919.1.9616 WP_000968919.1.96177 WP_000968919.1.96215 WP_000968919.1.96222 WP_000968919.1.96223 WP_000968919.1.96247 WP_000968919.1.96263 WP_000968919.1.96279 WP_000968919.1.96281 WP_000968919.1.96293 WP_000968919.1.96299 WP_000968919.1.96303 WP_000968919.1.96339 WP_000968919.1.96392 WP_000968919.1.96394 WP_000968919.1.9641 WP_000968919.1.96417 WP_000968919.1.96420 WP_000968919.1.96425 WP_000968919.1.96450 WP_000968919.1.96479 WP_000968919.1.96480 WP_000968919.1.96484 WP_000968919.1.9649 WP_000968919.1.96494 WP_000968919.1.965 WP_000968919.1.96519 WP_000968919.1.96558 WP_000968919.1.96562 WP_000968919.1.96608 WP_000968919.1.96609 WP_000968919.1.96650 WP_000968919.1.9668 WP_000968919.1.96680 WP_000968919.1.96683 WP_000968919.1.96695 WP_000968919.1.96701 WP_000968919.1.9671 WP_000968919.1.96725 WP_000968919.1.96743 WP_000968919.1.96753 WP_000968919.1.96759 WP_000968919.1.96762 WP_000968919.1.96769 WP_000968919.1.96779 WP_000968919.1.96796 WP_000968919.1.96817 WP_000968919.1.9682 WP_000968919.1.96850 WP_000968919.1.96894 WP_000968919.1.9690 WP_000968919.1.96907 WP_000968919.1.9691 WP_000968919.1.96932 WP_000968919.1.96936 WP_000968919.1.96971 WP_000968919.1.96984 WP_000968919.1.96989 WP_000968919.1.97011 WP_000968919.1.97027 WP_000968919.1.97049 WP_000968919.1.97059 WP_000968919.1.9708 WP_000968919.1.97119 WP_000968919.1.97123 WP_000968919.1.97147 WP_000968919.1.97170 WP_000968919.1.97193 WP_000968919.1.97195 WP_000968919.1.97200 WP_000968919.1.97226 WP_000968919.1.9723 WP_000968919.1.97231 WP_000968919.1.97269 WP_000968919.1.97279 WP_000968919.1.9729 WP_000968919.1.97292 WP_000968919.1.97351 WP_000968919.1.97356 WP_000968919.1.97360 WP_000968919.1.97361 WP_000968919.1.97379 WP_000968919.1.9740 WP_000968919.1.97402 WP_000968919.1.97418 WP_000968919.1.97421 WP_000968919.1.97434 WP_000968919.1.97437 WP_000968919.1.97439 WP_000968919.1.97459 WP_000968919.1.97464 WP_000968919.1.9747 WP_000968919.1.97513 WP_000968919.1.97527 WP_000968919.1.97538 WP_000968919.1.97549 WP_000968919.1.97560 WP_000968919.1.97571 WP_000968919.1.97619 WP_000968919.1.97632 WP_000968919.1.97667 WP_000968919.1.97675 WP_000968919.1.97677 WP_000968919.1.97685 WP_000968919.1.9770 WP_000968919.1.97705 WP_000968919.1.97711 WP_000968919.1.97770 WP_000968919.1.97775 WP_000968919.1.97789 WP_000968919.1.97798 WP_000968919.1.978 WP_000968919.1.97802 WP_000968919.1.97815 WP_000968919.1.97822 WP_000968919.1.97823 WP_000968919.1.97825 WP_000968919.1.97871 WP_000968919.1.97895 WP_000968919.1.97930 WP_000968919.1.97932 WP_000968919.1.97937 WP_000968919.1.97962 WP_000968919.1.97982 WP_000968919.1.97996 WP_000968919.1.98000 WP_000968919.1.98005 WP_000968919.1.98012 WP_000968919.1.9803 WP_000968919.1.98046 WP_000968919.1.98082 WP_000968919.1.98083 WP_000968919.1.981 WP_000968919.1.98102 WP_000968919.1.98115 WP_000968919.1.98139 WP_000968919.1.98155 WP_000968919.1.9816 WP_000968919.1.9817 WP_000968919.1.98176 WP_000968919.1.98187 WP_000968919.1.98202 WP_000968919.1.98205 WP_000968919.1.98208 WP_000968919.1.98220 WP_000968919.1.98235 WP_000968919.1.98239 WP_000968919.1.98241 WP_000968919.1.98244 WP_000968919.1.98251 WP_000968919.1.98279 WP_000968919.1.98284 WP_000968919.1.98294 WP_000968919.1.98312 WP_000968919.1.98323 WP_000968919.1.98355 WP_000968919.1.98357 WP_000968919.1.98384 WP_000968919.1.98400 WP_000968919.1.98404 WP_000968919.1.98424 WP_000968919.1.98429 WP_000968919.1.9844 WP_000968919.1.98442 WP_000968919.1.98451 WP_000968919.1.98466 WP_000968919.1.98477 WP_000968919.1.98480 WP_000968919.1.98484 WP_000968919.1.98498 WP_000968919.1.98543 WP_000968919.1.98549 WP_000968919.1.98569 WP_000968919.1.98587 WP_000968919.1.98603 WP_000968919.1.98614 WP_000968919.1.98628 WP_000968919.1.98633 WP_000968919.1.9864 WP_000968919.1.98641 WP_000968919.1.98654 WP_000968919.1.98665 WP_000968919.1.98668 WP_000968919.1.98702 WP_000968919.1.98776 WP_000968919.1.98784 WP_000968919.1.9883 WP_000968919.1.98849 WP_000968919.1.98875 WP_000968919.1.98886 WP_000968919.1.98908 WP_000968919.1.98920 WP_000968919.1.98976 WP_000968919.1.98988 WP_000968919.1.99006 WP_000968919.1.99029 WP_000968919.1.99053 WP_000968919.1.99060 WP_000968919.1.9907 WP_000968919.1.99101 WP_000968919.1.99110 WP_000968919.1.99119 WP_000968919.1.99168 WP_000968919.1.99182 WP_000968919.1.99234 WP_000968919.1.99246 WP_000968919.1.99265 WP_000968919.1.99289 WP_000968919.1.99292 WP_000968919.1.99295 WP_000968919.1.9930 WP_000968919.1.99302 WP_000968919.1.99306 WP_000968919.1.99307 WP_000968919.1.99310 WP_000968919.1.99319 WP_000968919.1.99334 WP_000968919.1.99345 WP_000968919.1.99349 WP_000968919.1.9935 WP_000968919.1.99361 WP_000968919.1.99392 WP_000968919.1.9940 WP_000968919.1.99400 WP_000968919.1.99427 WP_000968919.1.99446 WP_000968919.1.99453 WP_000968919.1.99458 WP_000968919.1.99471 WP_000968919.1.99472 WP_000968919.1.99475 WP_000968919.1.99486 WP_000968919.1.99487 WP_000968919.1.99498 WP_000968919.1.99501 WP_000968919.1.99511 WP_000968919.1.99571 WP_000968919.1.99602 WP_000968919.1.99603 WP_000968919.1.99619 WP_000968919.1.99632 WP_000968919.1.99641 WP_000968919.1.99692 WP_000968919.1.99694 WP_000968919.1.99698 WP_000968919.1.99734 WP_000968919.1.99771 WP_000968919.1.99774 WP_000968919.1.99791 WP_000968919.1.99804 WP_000968919.1.99827 WP_000968919.1.99869 WP_000968919.1.99874 WP_000968919.1.99891 WP_000968919.1.99892 WP_000968919.1.99912 WP_000968919.1.99986 YP_002407326.1.10275 YP_006120097.1.29421 gi|170680857|ref|YP_001743513.1| gi|254793354|ref|YP_003078191.1| gi|170081393|ref|YP_001730713.1| gi|110641856|ref|YP_669586.1| gi|387621454|ref|YP_006129081.1| gi|157157611|ref|YP_001463032.1| gi|215486953|ref|YP_002329384.1| gi|238900950|ref|YP_002926746.1| gi|209919097|ref|YP_002293181.1| gi|386619303|ref|YP_006138883.1| gi|56479914|ref|NP_707375.2| gi|291282915|ref|YP_003499733.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]