SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|218554664|ref|YP_002387577.1| from Escherichia coli IAI1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|218554664|ref|YP_002387577.1|
Domain Number 1 Region: 3-326
Classification Level Classification E-value
Superfamily ADP-ribosylglycohydrolase 3.53e-68
Family ADP-ribosylglycohydrolase 0.000036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|218554664|ref|YP_002387577.1|
Sequence length 334
Comment putative (phospho)hydrolase [Escherichia coli IAI1]
Sequence
MKTERILGALYGQALGDAMGMPSELWPRSRVKAHFGWIDRFLPGPKENNAACYFNRAEFT
DDTSMALCLADALLEREGKIDPDLIGRNILDWALRFDAFNKNVLGPTSKIALNAIRDGKP
VAELENNGVTNGAAMRVTPLGCLLPARDVDSFIDDVALASSPTHKSDLAVAGAVVIAWAI
SRAIDGESWSAIVDSLPSIARHAQQKRTTTFSASLAARLEIALKIVRNADGTESASEQLY
QVVGAGTSTIESVPCAIALVELAQTDPNRCAVLCANLGGDTDTIGAMATAICGALHGVNA
IDPALKAELDAVNQLDFNRYATALAKYRQQREAV
Download sequence
Identical sequences A0A026UUC8
585034.ECIAI1_2173 gi|218554664|ref|YP_002387577.1| WP_000846226.1.100066 WP_000846226.1.11524 WP_000846226.1.12566 WP_000846226.1.16194 WP_000846226.1.17961 WP_000846226.1.18000 WP_000846226.1.20519 WP_000846226.1.21104 WP_000846226.1.24136 WP_000846226.1.26055 WP_000846226.1.26325 WP_000846226.1.31860 WP_000846226.1.32709 WP_000846226.1.37773 WP_000846226.1.37887 WP_000846226.1.38120 WP_000846226.1.40596 WP_000846226.1.41147 WP_000846226.1.41263 WP_000846226.1.4142 WP_000846226.1.41988 WP_000846226.1.42962 WP_000846226.1.45968 WP_000846226.1.50996 WP_000846226.1.54591 WP_000846226.1.5460 WP_000846226.1.55115 WP_000846226.1.56799 WP_000846226.1.57487 WP_000846226.1.59293 WP_000846226.1.62041 WP_000846226.1.62850 WP_000846226.1.64008 WP_000846226.1.66926 WP_000846226.1.68442 WP_000846226.1.75999 WP_000846226.1.77626 WP_000846226.1.77949 WP_000846226.1.811 WP_000846226.1.82246 WP_000846226.1.86956 WP_000846226.1.88088 WP_000846226.1.894 WP_000846226.1.90626 WP_000846226.1.90864 WP_000846226.1.91643 WP_000846226.1.94317 WP_000846226.1.95243 WP_000846226.1.9690 WP_000846226.1.98665

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]