SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for LjSGA_032363.1 from Lotus japonicus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LjSGA_032363.1
Domain Number 1 Region: 165-244
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 7.03e-19
Family Leukotriene A4 hydrolase catalytic domain 0.0097
Further Details:      
 
Weak hits

Sequence:  LjSGA_032363.1
Domain Number - Region: 106-203
Classification Level Classification E-value
Superfamily ABC transporter involved in vitamin B12 uptake, BtuC 0.0811
Family ABC transporter involved in vitamin B12 uptake, BtuC 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) LjSGA_032363.1
Sequence length 262
Comment + phase: 1 /pseudo/partial
Sequence
SVLNVRLKASVKLHFIRIGLIXWLSIQFASRQINHCIRCYCLMETCLNKVTXRMASIILF
GRTPSRNLVICLPWLLGNCRAEMTLSLPVPDGKCPLGSGHLQMTYLRLHMLCILXKQLXS
GMKMFLGLNMTWISSMLLLSQILTWELWKIRAXTYVSFLSACLGWLYIFNSKLVLASPET
ATDADYAAILGVIGHEYFHNWTGNRVTCRDWFQLSLKEGLTVFRDQEFSADLGSRTVKRI
ADVSKLEITSFHRLLIFAFFFH
Download sequence
Identical sequences LjSGA_032363.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]