SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for LjSGA_070220.1 from Lotus japonicus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LjSGA_070220.1
Domain Number 1 Region: 88-210
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 6.95e-23
Family Tetracyclin repressor-like, C-terminal domain 0.0078
Further Details:      
 
Domain Number 2 Region: 11-84
Classification Level Classification E-value
Superfamily Homeodomain-like 4.98e-17
Family Tetracyclin repressor-like, N-terminal domain 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) LjSGA_070220.1
Sequence length 210
Comment - phase: 0 /partial
Sequence
QPRRPGRPSCGAKGADKREHLLDTALNLFARQGIVDTSLNAIAREANVTPAMLHYYFHNR
EQLLDVLIEERFLPVRKMAGEVFDANADDPVTAFTQLAQRFIDIALEHPWFAPLWLREVM
SESGVLKQRMDERFGNERHQIALQAIARWQAQGKLNPDLEPALLFFTLFGITLLPLATAP
KWRRERDKGQLNAEDIARHAIALLRYGIGP
Download sequence
Identical sequences LjSGA_070220.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]