SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for chr2.LjT34P04.90.nd from Lotus japonicus

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  chr2.LjT34P04.90.nd
Domain Number - Region: 30-73
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 0.0689
Family Tetracyclin repressor-like, C-terminal domain 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) chr2.LjT34P04.90.nd
Sequence length 178
Comment - phase: 0
Sequence
MKDDDGLPTTTAPTAKKDNLDSGLFGKGRYKFWALAAILLLAFWSMFTGTVSLRWSGNLN
SLSNDLDTPIHDDLDVLEMEEREKVVRHMWDVYTNSRRIRLPRFWQEAFEAAYEELTSDA
PGVRDAAITEIAKMSVRSIDFDPPPIQSTVRPSILFSTIRVLLLFNIYNFEIHTLWCY
Download sequence
Identical sequences chr2.LjT34P04.90.nd

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]