SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for LjSGA_145690.1 from Lotus japonicus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LjSGA_145690.1
Domain Number 1 Region: 64-103
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000334
Family B3 DNA binding domain 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) LjSGA_145690.1
Sequence length 110
Comment + phase: 0 /partial
Sequence
LQASTNQELNQEIPHFNLPSKIFCRVVNIQLLAEQDTDEVYACVALLPESDQTEPENLDL
TPSEAPKDKFHSFCTILTASDTSTHGGFSVLRKHATECLPPLGISSLGFL
Download sequence
Identical sequences LjSGA_145690.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]