SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for chr6.CM0302.130.nc from Lotus japonicus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  chr6.CM0302.130.nc
Domain Number 1 Region: 150-220
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000275
Family B3 DNA binding domain 0.01
Further Details:      
 
Weak hits

Sequence:  chr6.CM0302.130.nc
Domain Number - Region: 23-103
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0159
Family B3 DNA binding domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) chr6.CM0302.130.nc
Sequence length 233
Comment - phase: 0
Sequence
MAQVRLSSLPEDANNFIIIHRSESDLALLPRRFVRNNPIIMPYQNALLTDPANNTFSVSL
RTVNRDKGIESFQEIYQAHHITGTVRVHYTYIRGSQFYIRIFHDEYTEVAYIEQEDSDDD
YVVIEQEDSDDEDELAWLSDITEPRSYGRQCLHVPANVAIELIPHRPPSLNIILPYGNLD
EWFLKWADGRPNQVDFGHGWYEFGREERIRARDQLRFYKTHQPDTYRLEVRRY
Download sequence
Identical sequences chr6.CM0302.130.nc

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]