SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for chr6.CM0420.10.nd from Lotus japonicus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  chr6.CM0420.10.nd
Domain Number 1 Region: 64-132
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.62e-29
Family B3 DNA binding domain 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) chr6.CM0420.10.nd
Sequence length 172
Comment + phase: 1 /pseudo/partial
Sequence
ARADPSSGFLFFXVPILYYTIHKLICFSILDQADPETDEVYAQMTLQPVNKYDKEAMLAS
DMGLKQNNQPTEFFCKTLTASDTSTHGGFSVPRRAAEKIFPPLDFSMQPPAQEIVAKDLH
DNTWTFRHIYRGILTLTFLSLPSSFTLFYHWVHWDLNHCHMVSWLGMATLIL
Download sequence
Identical sequences chr6.CM0420.10.nd

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]