SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|383487910|ref|YP_005405589.1| from Rickettsia prowazekii str. Chernikova

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383487910|ref|YP_005405589.1|
Domain Number 1 Region: 10-318
Classification Level Classification E-value
Superfamily SIS domain 4.67e-57
Family mono-SIS domain 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|383487910|ref|YP_005405589.1|
Sequence length 319
Comment arabinose-5-phosphate isomerase [Rickettsia prowazekii str. Chernikova]
Sequence
MINTNNYRIIAKRVISSATSALETLSNNIPSDFNRIIEFLLSFKGRIILTGIGKSGYIAR
KIAASFSSTGMPSFYLHPAEASHGDLGMITRNDLVMMLSNSGETKELFNIIEYCNNSSIK
IAAMTMNKNSTLAKRSDFLLKIPECQEASLIGTPTISSLIMLSLGDAIMTVIHEERGFTR
DDFKIYHPGGTIGANLTKIKNIMRSGDEIPLVYEDTSFTETIIIMNKKRLGCTLVTDKEQ
NLIGIITDGDLRRNIHDQIHLKTASSIMTKNPHYISSEIFAQEALNLMKAKNITNIPIVD
DNIIIGIIHIHDLLSMGVS
Download sequence
Identical sequences D5AX94 Q9ZD42
gi|383487332|ref|YP_005405012.1| gi|15604365|ref|NP_220881.1| gi|383487910|ref|YP_005405589.1| gi|383488756|ref|YP_005406434.1| 272947.RP505 gi|478693481|ref|YP_007750388.1| gi|383500572|ref|YP_005413932.1| gi|386082354|ref|YP_005998931.1| gi|383499736|ref|YP_005413097.1| gi|383489596|ref|YP_005407273.1| gi|478692994|ref|YP_007749902.1| NP_220881.1.81248 WP_004597752.1.19079 WP_004597752.1.38548 WP_004597752.1.39958 WP_004597752.1.61965 WP_004597752.1.6643 WP_004597752.1.75108 WP_004597752.1.80123 WP_004597752.1.82014 WP_004597752.1.8209 WP_004597752.1.9355 WP_004597752.1.96644

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]