SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|217076435|ref|YP_002334151.1| from Thermosipho africanus TCF52B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|217076435|ref|YP_002334151.1|
Domain Number 1 Region: 5-134
Classification Level Classification E-value
Superfamily AF1862-like 5.62e-27
Family Cas Cmr5-like 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|217076435|ref|YP_002334151.1|
Sequence length 136
Comment cmr CRISPR-associated protein, Cmr5 family [Thermosipho africanus TCF52B]
Sequence
MRNKIEIKNFSQNKIKENLKEMESNDELKKSYKSLVKSLGALVLQNGLYASIVFIISKTK
DKNNYYYVLKDIQKFLKEYFKDSYVVNNKDIKDIKQEVLEFLESESFKKAYKQFSEQFIE
FIKWHRRYVDIYIDID
Download sequence
Identical sequences B7IFE6
484019.THA_310 gi|217076435|ref|YP_002334151.1| WP_012579489.1.97851

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]