SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|217077094|ref|YP_002334810.1| from Thermosipho africanus TCF52B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|217077094|ref|YP_002334810.1|
Domain Number 1 Region: 1-177
Classification Level Classification E-value
Superfamily Ligand-binding domain in the NO signalling and Golgi transport 2.41e-35
Family H-NOX domain 0.0000449
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|217077094|ref|YP_002334810.1|
Sequence length 341
Comment membrane associated methyl-accepting chemotaxis protein [Thermosipho africanus TCF52B]
Sequence
MKSFVMNIWITTWKKLYGENIVNELSSKFNLDEQNLLIPTNNVPDELVVNFSRELAKKVG
KTYEELWQETGYHNIKSFHSFYPSYFKKEGVLSFLSAMDSVHRALTRRIKGAKPPRIIYN
YIDEKTAVIRYESHRDFRNYFLGLLKGAADFFNDPLKIEILKQDMNSNGSFIEVKVTATK
PYGKSVKLKLYKAISFGLLKSFSTNLTVIIPILTFVLSFLFTKYLGALPGSILTSISILI
GLLLINKDLKNATKSVEKIINIYKEKDFNDILMISGEKDFEKLSKSNIKALSNLREFLIG
FQGDTEEILNFSKKTLESSDAIQEEIGTMKELYCSPEGLDS
Download sequence
Identical sequences B7IHA5
gi|217077094|ref|YP_002334810.1| 484019.THA_1011

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]