SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|217076583|ref|YP_002334299.1| from Thermosipho africanus TCF52B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|217076583|ref|YP_002334299.1|
Domain Number 1 Region: 2-206
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.66e-56
Family G proteins 0.00011
Further Details:      
 
Domain Number 2 Region: 166-288
Classification Level Classification E-value
Superfamily Translation proteins 9.9e-30
Family Elongation factors 0.003
Further Details:      
 
Domain Number 3 Region: 400-496
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 1.01e-22
Family EF-G/eEF-2 domains III and V 0.0062
Further Details:      
 
Domain Number 4 Region: 293-371
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 4.32e-16
Family EF-G/eEF-2 domains III and V 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|217076583|ref|YP_002334299.1|
Sequence length 603
Comment GTP-binding protein LepA [Thermosipho africanus TCF52B]
Sequence
MRNVRNISIIAHIDHGKTTLTDRILEITGAIEKRKMREQFLDSMDIERERGITIKSHPLR
VFYKSKKDGKEYEINIVDTPGHVDFSYEVDRSLAAVEGAILLVDASQGVQAQTVANTYKA
LEHNLEIIPAINKIDLPNANVAETELEIEDLIGIPSSEILKISAKEGIGVEELLEEIIEK
VPAPSGDEDGKLKALIFDAKYDKYRGVIVYIRVFDGKVSIGDKIMTFSNGQSYEVIETGV
FTPDMTPVDELKAGDIGYIIAGIKEVSLARIGDTITNAIDPVEEPLEGYKEVKPMVFAGM
FPGVPEYYEELRKALEKLKLNDSALVFYPDHSPALGFGFRCGFLGLLHMDVVKERLEREF
EMTVILTAPNVEYKVLLKNGEELIVNDPAKFPDESTIQEVYEPYVKLSIITPPEYLGRLM
NLVQNEKRGTMISTENAGFERVVLNFEVPLAEIIFDFFDKMKALSRGYASMDYEFIGYRK
SDLVKVSILVNKEPVDALSIIAHKDKAYSMARKLVDKLAELIPQHQFEIPIQAKAGGRII
ARSTIKALRKDVLAKCYGGDVTRKMKLLQKQKEGKKKLREIGNVSIPQEAFLALLKVGED
ENK
Download sequence
Identical sequences B7IFU4 K2PMC6
gi|217076583|ref|YP_002334299.1| 484019.THA_467 WP_004104247.1.53850 WP_004104247.1.97851

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]