SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|217077280|ref|YP_002334998.1| from Thermosipho africanus TCF52B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|217077280|ref|YP_002334998.1|
Domain Number 1 Region: 10-284
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.39e-109
Family G proteins 0.0000000174
Further Details:      
 
Domain Number 2 Region: 480-600
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.53e-46
Family Translational machinery components 0.00000741
Further Details:      
 
Domain Number 3 Region: 268-405
Classification Level Classification E-value
Superfamily Translation proteins 1.04e-38
Family Elongation factors 0.0000617
Further Details:      
 
Domain Number 4 Region: 604-690
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 4.41e-27
Family EF-G/eEF-2 domains III and V 0.0001
Further Details:      
 
Domain Number 5 Region: 403-481
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 1.04e-25
Family EF-G/eEF-2 domains III and V 0.000052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|217077280|ref|YP_002334998.1|
Sequence length 691
Comment elongation factor G [Thermosipho africanus TCF52B]
Sequence
MKEIQAIYVDLKKLRNIGIMAHIDAGKTTTTERILFYTGRKHNIGSVDDGTATMDWMVQE
KERGITIVSAATTCMWKDHRINIIDTPGHVDFTIEVERALRVLDGAVAVFDAAAGVEPQS
ETVWRQADKYNVPRIAFMNKMDKLGADFEMAVQTMVDRLKANPIPVQMPMGAEDSFEGVI
DLIEMKAIRWLNENGTEMVYEEIPEKYRAKAEEMREDLLEKVAELDDEIMMLYLEGEEIS
NDLIKKALRKATIENKATPVFCGSAKMNRGVQPLLDGILEYLPSPLDMPPVRGWNQNGEE
VQIKPSEDEPFTALAFKIQADPYVGKLTFFRVYSGRLEKGSYVYNSTKGKKERISRLIFM
HADKREDVEYVRAGDIVAAIGLKDTKTGDTLCDEKRPVILEKMEFPEPVISIAIEPETKN
DQDKLSKALTLLSDEDPSFRAYVDHETGETIISGMGELHLEIIVDRLKREFNTKVRVGQP
QVAYRETIQEPAEAEGKYIRQSGGRGQYGHVIMRFEPIDLSKTFEFEDRIVGGVIPKEYI
PAVEEGVREAAQSGVLAGYPMVGIKAILLDGSYHEVDSSEMAFKIAASMAFKEAVKKAKP
ILLEPIMRVEVTTPEEYMGNIIADLNSRRAHVETLESRGHLRIIKALVPLSEMFGYATDL
RSLSQGRATYTMVLERYAKVPDKLAEKIISK
Download sequence
Identical sequences B7IHU3 K2PDI9
WP_004101432.1.53850 WP_004101432.1.97851 gi|217077280|ref|YP_002334998.1| 484019.THA_1212

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]