SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|217077691|ref|YP_002335409.1| from Thermosipho africanus TCF52B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|217077691|ref|YP_002335409.1|
Domain Number 1 Region: 5-263
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.07e-69
Family G proteins 0.0000121
Further Details:      
 
Domain Number 2 Region: 465-585
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.53e-46
Family Translational machinery components 0.0000118
Further Details:      
 
Domain Number 3 Region: 586-678
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 1.53e-26
Family EF-G/eEF-2 domains III and V 0.00032
Further Details:      
 
Domain Number 4 Region: 389-466
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 8.27e-21
Family EF-G/eEF-2 domains III and V 0.00014
Further Details:      
 
Domain Number 5 Region: 240-262,291-380
Classification Level Classification E-value
Superfamily Translation proteins 9.9e-20
Family Elongation factors 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|217077691|ref|YP_002335409.1|
Sequence length 685
Comment translation elongation factor G [Thermosipho africanus TCF52B]
Sequence
MGAVDKKRTISLIGHNGSGKSVLLSSMLFNAGVLDKIGNKDIDYDPIEGEKGSSLSSHIA
SFNFDGTQYTVIDTPGFSDFVGEVINAIYVTENIVSVVNATAGVEIQTERTWAIAEEMKK
PIAVFINQMDKERANFEESLESLKERFEKNFVPIFYPIGAEDSFKGIVDIFSSKAFVYEN
GKAKEVEVPAELKDKIEELKSSMIEDIVSLDEELMERYFNDEEISAEELLKTLKKGYKTG
EIVPVFCGSAEKNIAVDQFLKVMTILGVNPSEGNSYKAVLETGDEVEVVPVEDEPIVAYT
FKAIVDQFVGKLSFLKIISGKLSSGDTLINVNKGTSEKIGHLYLPVLKSTNEVPEASCGD
IIVIPKLKESSVGDTMTHKDRKLKIVPPEFPEPMISKSINPKSKSDIDKISNGLARLADS
DPTFSWEFDPETSETVISGIGNIHLDVMVERLKNIFGVDVEVGKPKIAYRETIMGKAIGE
HKHKKQTGGHGQYGHVKIEIEPLERGKGFEFVDKIVGGVIPKNFIPSVEKGIREAMKKGS
LAAYPVVDIRVTLFDGSYHEVDSSDISFQIAAIQAFRKAFEQAKPVLLEPVMEVSVFVPD
ENAGDVMGEISSRRGRPHGMEPAGKGITKITAEVPLAEMLDFSGRLSSITSGRGYFTMKF
SKYDIVPPNVQEKIIQERKRELEQE
Download sequence
Identical sequences B7IDJ1
WP_012580309.1.97851 484019.THA_1630 gi|217077691|ref|YP_002335409.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]