SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|389860429|ref|YP_006362668.1| from Thermogladius cellulolyticus 1633

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|389860429|ref|YP_006362668.1|
Domain Number 1 Region: 138-356
Classification Level Classification E-value
Superfamily Creatinase/aminopeptidase 7.07e-69
Family Creatinase/aminopeptidase 0.00000834
Further Details:      
 
Domain Number 2 Region: 4-138
Classification Level Classification E-value
Superfamily Creatinase/prolidase N-terminal domain 0.0000000488
Family Creatinase/prolidase N-terminal domain 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|389860429|ref|YP_006362668.1|
Sequence length 365
Comment peptidase M24 [Thermogladius cellulolyticus 1633]
Sequence
MLWKVEEIAERRGLDAVIIVSPENVEYFTGVKSLADGIVLLFYDRRRRSTQVYTPLLDYY
RYRDSLEASGVEVYGLSKTLKPSDARVVNKDWAELVKTLAGGGKVGLDARFTSPLMGVVM
RSLGEYVDVSDDVSKYRMVKEDWEIELIKRAVDVTIQGIRAVVDSVDVGVSEAELAGVFE
GAVRKMGVEDYAFPLIVSTSPNNSYPHNTPTTAKVKQGDLIVIDVGVRIGGRCSDLTRVV
KVGSIPGEFKRLVDVVVEAVSESLDYVHPGVKAGEVAERAIAVVERHGLKERFIHGLGHG
IGVVVHEPPYLRVGHETVLEKNMVFTIEPGVYIPGVVGVRIEEDVLVDERGARVLSSSLS
QVLEA
Download sequence
Identical sequences I3TCP2
gi|389860429|ref|YP_006362668.1| WP_014736781.1.39459

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]