SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|389860580|ref|YP_006362820.1| from Thermogladius cellulolyticus 1633

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|389860580|ref|YP_006362820.1|
Domain Number - Region: 15-80
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0331
Family Recombinase DNA-binding domain 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|389860580|ref|YP_006362820.1|
Sequence length 135
Comment hypothetical protein TCELL_0257 [Thermogladius cellulolyticus 1633]
Sequence
MKSILEFAARHVEPSLKRSLAIKLLARGVDRGKVSTCLGISPALLTRYIKGERGLHDFTR
IKDVDERLDKLAEEVASGRKCGLDAYTELLNLTFYVLYKKYACGIHYVATRDVNPAKCNA
CPALFGKLFEWRFQH
Download sequence
Identical sequences I3TD44
WP_014736932.1.39459 gi|389860580|ref|YP_006362820.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]