SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|389860797|ref|YP_006363037.1| from Thermogladius cellulolyticus 1633

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|389860797|ref|YP_006363037.1|
Domain Number 1 Region: 17-192
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 1.92e-44
Family HD domain 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|389860797|ref|YP_006363037.1|
Sequence length 199
Comment metal dependent phosphohydrolase [Thermogladius cellulolyticus 1633]
Sequence
MEGVVAEARRVARESLGSDFDHGYPHVERVRKWAWEIVREEGLKVDPLVLDLSVYLHDVG
RVIGEPHAYYSAVFAAGFLRRWGLDDAVVEKVVNAIEYHSFSYSRSKKVWPMSTEALVLS
DADKLDALGVVGFLRVFAYNWKTGGSMDDIIRHFHEKIFRLKDLMHFSYSKRKAEELTSR
VERVVKELVEELSSSGKES
Download sequence
Identical sequences I3TDR1
WP_014737149.1.39459 gi|389860797|ref|YP_006363037.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]