SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|389860802|ref|YP_006363042.1| from Thermogladius cellulolyticus 1633

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|389860802|ref|YP_006363042.1|
Domain Number - Region: 42-75
Classification Level Classification E-value
Superfamily Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain 0.000719
Family Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain 0.013
Further Details:      
 
Domain Number - Region: 22-49
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00523
Family LIM domain 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|389860802|ref|YP_006363042.1|
Sequence length 89
Comment hypothetical protein TCELL_0479 [Thermogladius cellulolyticus 1633]
Sequence
MTVGLLRGAEKSGHKGWTTVYCAICNKKLDLFAAYDTKDVFYCPTCVSKGRDAYFCSADA
RRLHYRCPYCGGELKPYFPLEETFRQQRP
Download sequence
Identical sequences I3TDR6
WP_014737154.1.39459 gi|389860802|ref|YP_006363042.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]