SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|389860821|ref|YP_006363061.1| from Thermogladius cellulolyticus 1633

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|389860821|ref|YP_006363061.1|
Domain Number 1 Region: 253-611
Classification Level Classification E-value
Superfamily SIS domain 9.8e-99
Family double-SIS domain 0.00000222
Further Details:      
 
Domain Number 2 Region: 2-234
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 4.72e-67
Family Class II glutamine amidotransferases 0.00000288
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|389860821|ref|YP_006363061.1|
Sequence length 611
Comment D-fructose-6-phosphate amidotransferase [Thermogladius cellulolyticus 1633]
Sequence
MCGIIGVCTRVDKKLNTGDVVYKGLLRLEYRGYDSAGVASVEQGVLRVLKGKGKIADLEK
KLGLSRVKGSVVIGHTRWATHGAPSDVNAHPHTDCTGTIAIVHNGIIENYRELKEELAKR
GHVFKSETDTEVVVHLIEEFYKSGDRPYDAFKKAVSMIRGSYAILVVFASAPNTIFFAKK
DSPLVVGLGDVANFVASDIPAILEHTRRVITLRDGWVGFVTGDSVFIEELGKGPVNPMEY
VRVVEWSLESASKGGYPHFMLKEIHEQPRALVDTLYGLSSDPTLREASKIMAEARRVFIT
AAGTSYHASLHFAVALSKIAGVLATPFVASEYEAYLPVVREGDVLIAVSQSGETMDTLKA
ARAFKERGAKLIAVSNVVDSAIPRESDIALYTRAGPEIGVAATKTFTTQTLLLSFLVLDY
ALLRGAILKSEYDEYARELSRASDLAAKSIAWSEGLAKKVSEMLRLKQSMYYLSRGVGLP
TAMEGALKIKELAYIHAESYPAGESKHGPIALVEEGFPVVFVVPRDVYYEKVLLGNIQEM
KARGAWIIGVAPEDTSLGEQFDLFFRVPSSHWLTTPITHTPPMQLLAYYTSTLKGYDPDK
PRNLAKTVTVE
Download sequence
Identical sequences I3TDT5
gi|389860821|ref|YP_006363061.1| WP_014737173.1.39459

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]