SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|389860881|ref|YP_006363121.1| from Thermogladius cellulolyticus 1633

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|389860881|ref|YP_006363121.1|
Domain Number 1 Region: 192-599
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.45e-90
Family Amylase, catalytic domain 0.000000423
Further Details:      
 
Domain Number 2 Region: 605-671
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 0.0000566
Family alpha-Amylases, C-terminal beta-sheet domain 0.0098
Further Details:      
 
Weak hits

Sequence:  gi|389860881|ref|YP_006363121.1|
Domain Number - Region: 93-175
Classification Level Classification E-value
Superfamily E set domains 0.000148
Family E-set domains of sugar-utilizing enzymes 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|389860881|ref|YP_006363121.1|
Sequence length 673
Comment pullulanase [Thermogladius cellulolyticus 1633]
Sequence
MKSTMPSLKKTLGAAVLVSILALILANELWVLTQQGREQISTQTKTSSQVSTTTTYTPST
TSSAYTTTPGTTTSPNSATAFPVEEYLGSGGSSAVFNPADPAFLSVADGGVVLRLTTPAG
TYSSVYVVVNGTSIEMKRQLKWSGYEMWYARVDGVGPFEYYFVLATSEGRRVYLYNTTER
PLFNFDGVDRFPQVRWVVGSVGYQIFPDRFYNGDPTNDLLANRTDELCLNAFSTSRPAFS
NWSDPITPLHCCHQYFGGDLKGITMKLGYLKSLGVDMIYLNPIFLSGSVHGYDTYDYLVV
DPKYGTQEDLRNLIIRAHDLGIRVIFDFVPDHVGIGFWAFLDVYEKGPSSKYWYWFTIYK
WPFKLGDSSAYRCWWGFGSLPQLNTTNPEVRDYLLNVALYWMDFGFDGMRIDTPTDLLGA
KDFFRELRALVKSKYPQAYIVGEIWDLDPSWLKGDLFDSLMFYSLGRGVLLAFSSGKITG
TQAAEALSVFYASIGANVAGMGFNVVDSHDTSRVLTDLGGGRLGDKPSYESIQRLKLLTV
LQFTMPGMPVIFQGDERGALGDKNHFDEQRYPIQWDQLIPEVYNHYLYLTTLKHTLPGLN
TSIIRVLYSSDDLLVYTRGYNDEVLVIANNGLIDHEVQLPEGAWRVVYPAGYQAVVVNKI
RVSPLSALILVKE
Download sequence
Identical sequences I3TDZ5
gi|389860881|ref|YP_006363121.1| WP_014737233.1.39459

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]