SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|389860908|ref|YP_006363148.1| from Thermogladius cellulolyticus 1633

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|389860908|ref|YP_006363148.1|
Domain Number 1 Region: 1-209
Classification Level Classification E-value
Superfamily Metallo-hydrolase/oxidoreductase 2.17e-20
Family Methyl parathion hydrolase 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|389860908|ref|YP_006363148.1|
Sequence length 235
Comment beta-lactamase [Thermogladius cellulolyticus 1633]
Sequence
MRVYVLVGGAPRKGFEQKRGLSIGVEYKGLYIVFDAGPDAYVIANNAGLSGFPLDLVDHV
VISHAHSPHIGGLEAIGWEAPFAKLYLPYASMETLGRQAQKWQLSPVEVVKETRVVDGVV
ISRPFHGPPWEHFMLVELESGRGEYALFTGCFHPAVRGVLADISNRYRVTTVIGGFHLET
APPETVRGFAEDIALRLRAERVFPLHCSGGLVGELLSERFKLDVRYLRTGDVVDL
Download sequence
Identical sequences I3TE22
WP_014737260.1.39459 gi|389860908|ref|YP_006363148.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]