SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|389861048|ref|YP_006363288.1| from Thermogladius cellulolyticus 1633

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|389861048|ref|YP_006363288.1|
Domain Number 1 Region: 7-174
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 3.4e-66
Family Inorganic pyrophosphatase 0.000000721
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|389861048|ref|YP_006363288.1|
Sequence length 176
Comment inorganic pyrophosphatase [Thermogladius cellulolyticus 1633]
Sequence
MSIFDKIGPGDKAPEVVNVVVEIPMNSGVKYEIDKETGIVQVDRVLFTSMVYPFNYGFIP
GTLEEDGDPVDVLVFMYDTLLPGSMIKVRPIGALETEDEKGRDIKIIAVPYEKIDARFEN
IKDINDLPEMVRQRIAHFFEHYKELEKGKWVKVVGWKNREEALQRIRNAIERAKRK
Download sequence
Identical sequences I3TEG2
WP_014737400.1.39459 gi|389861048|ref|YP_006363288.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]